DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sna and Scrt1

DIOPT Version :9

Sequence 1:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_570963.1 Gene:Scrt1 / 170729 MGIID:2176606 Length:348 Species:Mus musculus


Alignment Length:356 Identity:121/356 - (33%)
Similarity:160/356 - (44%) Gaps:66/356 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KDSQFAQDQPQDLSLKRGRDEETQDYQQPEPKRDYVLNLSKTPERNSSSSSNSCLLSPPVEAQDY 96
            :|..:..|.....|:..| |.|....:.|.|:..|.  .:...|...::|.:    :||...:..
Mouse    36 QDKGYLSDYVGPASVYDG-DAEAALLKGPSPEPMYA--AAVRGELGPAASGS----APPPTPRPE 93

  Fly    97 LPTEI--HMRGLTAGTTGYTTATPTTINPFQSAFVMAAGCNPISALWSSYQPHLAAFPSPASSMA 159
            |.|..  ::.|..|.:.||..          .||.:..|.:...|.    ..:.||.||.||..|
Mouse    94 LATAAGGYINGDAAVSEGYAA----------DAFFITDGRSRRKAA----NANAAAAPSTASVAA 144

  Fly   160 SPQSVYSYQQMTPPSSPGSDLETGSEPEDLSVRNDIPLPALFHLFDEAKSSSSGASVSSSSGYSY 224
                            |.||...|..|                   ..:.|.||   |:|.|.:.
Mouse   145 ----------------PDSDAGGGGGP-------------------GTRGSGSG---SASRGGTR 171

  Fly   225 TPAMSASSASVAANHAKNYRFKCDECQKMYSTSMGLSKHRQFHCPAAECNQEKKTHSCEECGKLY 289
            ..|.:.:.|...|..|.. |..|.||.|.|:||..||:|:|.|    .....:....|..|||:|
Mouse   172 VGAGTEARAGSGATGAGG-RHACGECGKTYATSSNLSRHKQTH----RSLDSQLARRCPTCGKVY 231

  Fly   290 TTIGALKMHIRTHTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLRAHQQ 354
            .::.|:.||:.||.|..||.:||||||||||||||:|:|||||||.|..|.::||||||||||.|
Mouse   232 VSMPAMAMHLLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQ 296

  Fly   355 THVDVKKYACQVCHKSFSRMSLLNKHSSSNC 385
            ||...|.:.|:.|.|||:..|.||||..|.|
Mouse   297 THSAFKHFQCKRCKKSFALKSYLNKHYESAC 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 16/19 (84%)
zf-H2C2_2 321..344 CDD:290200 14/22 (64%)
zf-C2H2 334..356 CDD:278523 14/21 (67%)
C2H2 Zn finger 336..356 CDD:275368 13/19 (68%)
zf-H2C2_2 348..373 CDD:290200 14/24 (58%)
C2H2 Zn finger 364..380 CDD:275368 8/15 (53%)
C2H2 Zn finger 247..267 CDD:275368 11/19 (58%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-C2H2 306..328 CDD:278523 17/21 (81%)
COG5048 307..>356 CDD:227381 37/48 (77%)
Scrt1NP_570963.1 SNAG domain. /evidence=ECO:0000250 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..190 22/98 (22%)
zf-C2H2 191..213 CDD:278523 11/21 (52%)
C2H2 Zn finger 193..213 CDD:275368 11/19 (58%)
C2H2 Zn finger 224..241 CDD:275371 7/16 (44%)
COG5048 <245..>313 CDD:227381 44/67 (66%)
zf-C2H2 248..270 CDD:278523 17/21 (81%)
C2H2 Zn finger 250..270 CDD:275368 16/19 (84%)
zf-H2C2_2 263..286 CDD:290200 14/22 (64%)
C2H2 Zn finger 278..298 CDD:275368 13/19 (68%)
zf-C2H2 278..298 CDD:278523 13/19 (68%)
zf-H2C2_2 290..314 CDD:290200 13/23 (57%)
C2H2 Zn finger 306..322 CDD:275368 8/15 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.