Sequence 1: | NP_476601.1 | Gene: | wor / 34906 | FlyBaseID: | FBgn0001983 | Length: | 548 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_112599.2 | Gene: | SCRT1 / 83482 | HGNCID: | 15950 | Length: | 348 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 94/196 - (47%) |
---|---|---|---|
Similarity: | 117/196 - (59%) | Gaps: | 24/196 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 302 SQPGGSGAIVDQTEFCTDQASALIQA---ANVASAQSMQKPVGVPRYHCQDCGKSYSTYSGLSKH 363
Fly 364 QQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCPICGKAFSRPWLLQGHIRTH 428
Fly 429 TGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAKHLQSGCQTEQSGGP 493
Fly 494 S 494 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
wor | NP_476601.1 | C2H2 Zn finger | 270..290 | CDD:275368 | |
C2H2 Zn finger | 317..334 | CDD:275368 | 4/19 (21%) | ||
zf-C2H2 | 345..367 | CDD:278523 | 11/21 (52%) | ||
C2H2 Zn finger | 347..367 | CDD:275368 | 11/19 (58%) | ||
PHA00732 | 379..>417 | CDD:177300 | 19/37 (51%) | ||
C2H2 Zn finger | 382..402 | CDD:275368 | 9/19 (47%) | ||
zf-C2H2_8 | 405..482 | CDD:292531 | 53/76 (70%) | ||
zf-C2H2 | 406..428 | CDD:278523 | 17/21 (81%) | ||
C2H2 Zn finger | 408..428 | CDD:275368 | 16/19 (84%) | ||
zf-H2C2_2 | 421..444 | CDD:290200 | 16/22 (73%) | ||
zf-C2H2 | 434..456 | CDD:278523 | 17/21 (81%) | ||
C2H2 Zn finger | 436..456 | CDD:275368 | 16/19 (84%) | ||
zf-H2C2_2 | 448..473 | CDD:290200 | 16/24 (67%) | ||
C2H2 Zn finger | 464..481 | CDD:275368 | 8/16 (50%) | ||
SCRT1 | NP_112599.2 | SNAG domain. /evidence=ECO:0000250 | 1..20 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 129..189 | 10/35 (29%) | |||
C2H2 Zn finger | 224..244 | CDD:275368 | 9/19 (47%) | ||
COG5048 | <245..>313 | CDD:227381 | 48/67 (72%) | ||
C2H2 Zn finger | 250..270 | CDD:275368 | 16/19 (84%) | ||
C2H2 Zn finger | 278..298 | CDD:275368 | 16/19 (84%) | ||
C2H2 Zn finger | 306..322 | CDD:275368 | 7/15 (47%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2462 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |