DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wor and snai1b

DIOPT Version :9

Sequence 1:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_571064.2 Gene:snai1b / 792194 ZFINID:ZDB-GENE-980526-514 Length:256 Species:Danio rerio


Alignment Length:150 Identity:97/150 - (64%)
Similarity:113/150 - (75%) Gaps:8/150 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 RYHCQDCGKSYSTYSGLSKHQQFHCPSAEG--------NQVKKVFSCKNCDKTYVSLGALKMHIR 400
            |:.|..||||.|:.:.||:||..||...:|        ...:..|.||:|.|.|.||||||||||
Zfish   103 RFQCAHCGKSCSSPAALSRHQLAHCSPQDGISGATSSLTSSRAAFHCKHCPKEYNSLGALKMHIR 167

  Fly   401 THTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCP 465
            :|||||.|..|||||||||||:|||||||||:||||.|||||||||||||||:||||:||||.|.
Zfish   168 SHTLPCVCSTCGKAFSRPWLLRGHIRTHTGERPFSCPHCNRAFADRSNLRAHLQTHSEVKKYQCG 232

  Fly   466 TCTKSFSRMSLLAKHLQSGC 485
            :|:::|||||||.||..|||
Zfish   233 SCSRTFSRMSLLHKHTLSGC 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368
C2H2 Zn finger 317..334 CDD:275368
zf-C2H2 345..367 CDD:278523 10/21 (48%)
C2H2 Zn finger 347..367 CDD:275368 10/19 (53%)
PHA00732 379..>417 CDD:177300 27/37 (73%)
C2H2 Zn finger 382..402 CDD:275368 15/19 (79%)
zf-C2H2_8 405..482 CDD:292531 61/76 (80%)
zf-C2H2 406..428 CDD:278523 17/21 (81%)
C2H2 Zn finger 408..428 CDD:275368 16/19 (84%)
zf-H2C2_2 421..444 CDD:290200 19/22 (86%)
zf-C2H2 434..456 CDD:278523 19/21 (90%)
C2H2 Zn finger 436..456 CDD:275368 17/19 (89%)
zf-H2C2_2 448..473 CDD:290200 16/24 (67%)
C2H2 Zn finger 464..481 CDD:275368 10/16 (63%)
snai1bNP_571064.2 C2H2 Zn finger 149..169 CDD:275368 15/19 (79%)
C2H2 Zn finger 175..195 CDD:275368 16/19 (84%)
zf-H2C2_2 188..211 CDD:316026 19/22 (86%)
zf-C2H2 201..223 CDD:306579 19/21 (90%)
C2H2 Zn finger 203..223 CDD:275368 17/19 (89%)
C2H2 Zn finger 231..247 CDD:275368 9/15 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11461
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X955
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.