DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wor and sqz

DIOPT Version :9

Sequence 1:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_524403.1 Gene:sqz / 42300 FlyBaseID:FBgn0010768 Length:535 Species:Drosophila melanogaster


Alignment Length:421 Identity:103/421 - (24%)
Similarity:139/421 - (33%) Gaps:164/421 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 QNVARAL---------LSMQHMAPQHAPPPIDMEED-----QENQDINQLKIKSSNDLYYQCQQC 273
            ||||..|         ...|.|..:..|.|...::.     |:.|...|||:             
  Fly    49 QNVAERLDYSLKNGLVQHQQQMVMEQQPHPDQQQQQHLHHPQQQQHPPQLKV------------- 100

  Fly   274 NKCYATYAGLVKHQQTHAYESTEYKIIRSQP-------GGSGAIVDQTEFCT-----DQASALIQ 326
                 :|:........|..:..:|...||.|       .|||:.....|..:     |||     
  Fly   101 -----SYSAPNSPPTPHEQQEQKYDPNRSPPRQQMSSASGSGSNGSSPEEESRRGDGDQA----- 155

  Fly   327 AANVASAQSMQKPVGVPRYHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVS 391
                       ||     |.|..|.||::..|.||:|.:.|...       |.:.|:.|.:.:..
  Fly   156 -----------KP-----YKCGSCSKSFANSSYLSQHTRIHLGI-------KPYRCEICQRKFTQ 197

  Fly   392 LGALKMHIRTHT--LPCKC--PICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAH 452
            |..|:.||||||  .|.||  ..|.||||:...||.|.|.|..:|||.|..|.:.|:|...|..|
  Fly   198 LSHLQQHIRTHTGDKPYKCRHAGCPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEH 262

  Fly   453 MQTHSD---VKKYSCPTCTKSFSRMSLLAKHLQ--------------------------SGC--- 485
            :..|.|   :|.:.|..|.||:::.:.|.||||                          ||.   
  Fly   263 IPKHKDSKHLKTHICNLCGKSYTQETYLQKHLQKHAEKAEKQQHRHTAQVAAHQQHVPASGIGLN 327

  Fly   486 --------------------------------QTEQSGG-PSGSGGGFDQQQLQQHLQVYE---- 513
                                            |..|:|| |.|:.....||..||..::..    
  Fly   328 LQRQAMNDVNAAYWAKMGADSAAASLAEAIQQQLPQAGGQPYGNFASLQQQHQQQQQELLHHQRL 392

  Fly   514 -----EGHNPHQLYYAGSVGSSNGEEEEGGE 539
                 ..|:||              ||..||
  Fly   393 ADTPGHSHSPH--------------EEAAGE 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 1/19 (5%)
C2H2 Zn finger 317..334 CDD:275368 3/21 (14%)
zf-C2H2 345..367 CDD:278523 9/21 (43%)
C2H2 Zn finger 347..367 CDD:275368 8/19 (42%)
PHA00732 379..>417 CDD:177300 17/41 (41%)
C2H2 Zn finger 382..402 CDD:275368 7/19 (37%)
zf-C2H2_8 405..482 CDD:292531 32/81 (40%)
zf-C2H2 406..428 CDD:278523 11/23 (48%)
C2H2 Zn finger 408..428 CDD:275368 10/21 (48%)
zf-H2C2_2 421..444 CDD:290200 10/22 (45%)
zf-C2H2 434..456 CDD:278523 7/21 (33%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)
zf-H2C2_2 448..473 CDD:290200 9/27 (33%)
C2H2 Zn finger 464..481 CDD:275368 6/16 (38%)
sqzNP_524403.1 C2H2 Zn finger 160..180 CDD:275368 8/19 (42%)
zf-H2C2_2 172..197 CDD:290200 7/31 (23%)
zf-C2H2 186..208 CDD:278523 7/21 (33%)
C2H2 Zn finger 188..208 CDD:275368 7/19 (37%)
zf-C2H2_8 191..271 CDD:292531 33/79 (42%)
zf-H2C2_2 200..227 CDD:290200 14/26 (54%)
C2H2 Zn finger 216..238 CDD:275368 10/21 (48%)
C2H2 Zn finger 246..266 CDD:275368 6/19 (32%)
C2H2 Zn finger 277..297 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.