DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wor and CG4820

DIOPT Version :9

Sequence 1:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster


Alignment Length:405 Identity:89/405 - (21%)
Similarity:144/405 - (35%) Gaps:95/405 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 LLKSIAEYEDCMKMQNIKEEIPP---------IPSPQLFYPPPTPLAEPEDLSVTQRRVLSENMN 221
            ||:.:....:|. :||: :::|.         :...|.|   ....|:.|.....:||    .||
  Fly    28 LLQCVRSITNCW-LQNV-QDLPNHICTDCQVLLSQVQKF---RRRCAKIEKYFARRRR----RMN 83

  Fly   222 LQNVARAL--LSMQHMAPQHAPPPIDMEEDQENQDIN----QLKIKSSNDLYYQCQQCNKCYATY 280
            |.....|:  |.:|..|   ||.|:.::|.....||.    ||:::......|...|.       
  Fly    84 LGEAPAAMEQLRVQQAA---APDPLGIDELMSASDIKIEPIQLQMEEDPQAPYPENQL------- 138

  Fly   281 AGLVKHQQTHAYESTEYKIIRSQPGGSGAIVDQTEFC-TDQASALIQAANVASAQSMQKPVGVPR 344
                  :|..:|.:...:.|...|...|..  |||.. |....|..::.|.|..:|.:..:.|.|
  Fly   139 ------EQALSYGNAPGEDILPLPEDYGEA--QTEVATTTNEPAQRRSKNTAKIKSKKHTMRVGR 195

  Fly   345 YHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCP 409
                               :..|....:..|.|::     .|:...|           ..||.|.
  Fly   196 -------------------KLIHVKVIDDKQPKRI-----VDRNGPS-----------AKPCICE 225

  Fly   410 ICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRM 474
            .||:.|.....|..|:..|||.|||.|..|::.......||.|...|:: ..|:|..|...:|..
  Fly   226 HCGRQFKDTSNLHVHLLRHTGTKPFECDQCHQKCYTLHLLRRHQLKHTE-GPYACTFCGLEYSTN 289

  Fly   475 SLLAKHLQSGCQTEQSGGPSGSGGGFDQQQLQQHLQVYEEGHNPHQLYY--AGSV-----GSSNG 532
            |...:|.:..|  ::...|........:.:...|.:|.:       |::  ||:.     .||:.
  Fly   290 SSRVRHEREAC--KKGRAPQSKWEIIKKGERTFHCEVCD-------LWFLRAGNFTQHINSSSHI 345

  Fly   533 EEEEGGEYQMQPPAI 547
            |.|...:.:..|.||
  Fly   346 ENERRKKRKSNPTAI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 2/19 (11%)
C2H2 Zn finger 317..334 CDD:275368 4/17 (24%)
zf-C2H2 345..367 CDD:278523 0/21 (0%)
C2H2 Zn finger 347..367 CDD:275368 0/19 (0%)
PHA00732 379..>417 CDD:177300 8/37 (22%)
C2H2 Zn finger 382..402 CDD:275368 2/19 (11%)
zf-C2H2_8 405..482 CDD:292531 26/76 (34%)
zf-C2H2 406..428 CDD:278523 7/21 (33%)
C2H2 Zn finger 408..428 CDD:275368 6/19 (32%)
zf-H2C2_2 421..444 CDD:290200 10/22 (45%)
zf-C2H2 434..456 CDD:278523 6/21 (29%)
C2H2 Zn finger 436..456 CDD:275368 5/19 (26%)
zf-H2C2_2 448..473 CDD:290200 7/24 (29%)
C2H2 Zn finger 464..481 CDD:275368 4/16 (25%)
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071 10/51 (20%)
C2H2 Zn finger 224..244 CDD:275368 6/19 (32%)
C2H2 Zn finger 252..272 CDD:275368 5/19 (26%)
C2H2 Zn finger 279..297 CDD:275368 5/17 (29%)
C2H2 Zn finger 322..339 CDD:275368 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457208
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.