DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wor and Neu2

DIOPT Version :9

Sequence 1:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster


Alignment Length:411 Identity:93/411 - (22%)
Similarity:145/411 - (35%) Gaps:108/411 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 EEQFPLRNYNNNLLKSIAEYEDCMKMQNIKEEIPPIPSPQLFYPPPTPLAEPE---DLSVTQRRV 215
            |:..||   :|.:.||..|     ..||..:.|........||.....:.|.|   |.|.....|
  Fly    28 EKHDPL---SNTICKSCLE-----DAQNAFDIIETYERSHQFYRFLKDVREEESENDGSGCSEEV 84

  Fly   216 LSENMNLQNVARALLSMQHMAPQHAPPPIDMEEDQENQDINQLKIKSSNDLYYQCQQCNKCYATY 280
            .:...:||:.|.                 |::...| .|||:..||:.....:.|..|.|.:...
  Fly    85 EAAERDLQDGAD-----------------DVDSGNE-PDINECDIKAKEKPGFSCSHCPKSFQVK 131

  Fly   281 AGLVKHQQTHAYESTEYKIIRSQPGGSGAIVDQTEFCTDQASALIQAANVASAQSMQKPVGVPRY 345
            :.|..|.::|..|                                            :|     :
  Fly   132 SNLKVHMRSHTGE--------------------------------------------RP-----F 147

  Fly   346 HCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTL--PCKC 408
            .|..|.||:...|||..|.:.|..       ::.|.|.:|.:::.:...||.||:.|..  ..:|
  Fly   148 TCSLCPKSFGYSSGLQNHMRTHTG-------ERPFQCSHCPRSFTAGHHLKAHIQMHERRGSLRC 205

  Fly   409 PICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSR 473
            |.|.|.|....:|:.|:.|||.|..|.|..|:::|.....|..||:.|.: :.::|..|:|.|:.
  Fly   206 PYCQKCFLTSLILKQHLATHTDETQFKCSQCSKSFQVEHELWMHMRVHQE-RLFTCGHCSKDFAL 269

  Fly   474 MSLLAKHLQSGCQTEQSGGPS-----GSGGGF----------DQQQLQQHLQVYEEGHNPHQLYY 523
            .:.|.:||....:..||...|     |.....          |:..|..||    :.|..::...
  Fly   270 HAYLKRHLSRNARCSQSSKASAHKTLGHSKALKCGKCPKTFTDRSALSTHL----KSHTKNKPLL 330

  Fly   524 AGSVGSSNGEEEEGGEYQMQP 544
            .|...|| |.:......|.:|
  Fly   331 EGPCKSS-GSKPAHSNAQRKP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 5/19 (26%)
C2H2 Zn finger 317..334 CDD:275368 0/16 (0%)
zf-C2H2 345..367 CDD:278523 8/21 (38%)
C2H2 Zn finger 347..367 CDD:275368 8/19 (42%)
PHA00732 379..>417 CDD:177300 13/39 (33%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
zf-C2H2_8 405..482 CDD:292531 25/76 (33%)
zf-C2H2 406..428 CDD:278523 7/21 (33%)
C2H2 Zn finger 408..428 CDD:275368 7/19 (37%)
zf-H2C2_2 421..444 CDD:290200 9/22 (41%)
zf-C2H2 434..456 CDD:278523 7/21 (33%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)
zf-H2C2_2 448..473 CDD:290200 8/24 (33%)
C2H2 Zn finger 464..481 CDD:275368 5/16 (31%)
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 11/42 (26%)
COG5048 <119..241 CDD:227381 39/177 (22%)
C2H2 Zn finger 121..141 CDD:275368 5/19 (26%)
zf-H2C2_2 133..158 CDD:290200 9/73 (12%)
C2H2 Zn finger 149..169 CDD:275368 8/19 (42%)
zf-H2C2_2 162..185 CDD:290200 6/29 (21%)
C2H2 Zn finger 177..197 CDD:275368 6/19 (32%)
C2H2 Zn finger 205..225 CDD:275368 7/19 (37%)
zf-C2H2_8 206..286 CDD:292531 25/80 (31%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
C2H2 Zn finger 260..297 CDD:275368 10/36 (28%)
C2H2 Zn finger 303..323 CDD:275368 4/23 (17%)
C2H2 Zn finger 353..373 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.