DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wor and CG10543

DIOPT Version :9

Sequence 1:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001369100.1 Gene:CG10543 / 37379 FlyBaseID:FBgn0034570 Length:1666 Species:Drosophila melanogaster


Alignment Length:467 Identity:97/467 - (20%)
Similarity:149/467 - (31%) Gaps:172/467 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 VLSENMNLQNVARALLSMQHMAPQ-------------HAPPPIDMEEDQENQDI----------N 256
            :.:.|.|..||:   |....:.||             |.|..:.|    ||.|:          |
  Fly   504 ISNNNNNSNNVS---LHRPQLTPQAQNQLAASMKPSDHIPISMPM----ENMDLKAGQAAHGTAN 561

  Fly   257 QLKIKSSNDLYYQCQQCNKCY-------ATYAGLVKHQQTHAYESTEYK---------------- 298
            .:....|:.|..|..|..|.|       :...|:::.||........::                
  Fly   562 AIMQGGSSSLASQLHQQQKPYNSSNNPLSMMGGMMQQQQQQHVAMPHHQRQMMMMPEDFPQHGAS 626

  Fly   299 IIRSQ--------------PGGSGAIVDQTEFCTDQASA--------------------LIQAAN 329
            ::.|:              |..||.:....|...:..||                    ||...:
  Fly   627 MMNSRQMPALAALSNLGDTPAMSGQLNSSLELDDNDLSADEDDDDLDHDLDELDAAKQQLIDGGS 691

  Fly   330 VASAQSMQKPVG-------------------VPRYHCQDCGKSYSTYSGLSKHQQFH------CP 369
             :|:.|:|.|..                   .|.|:|..|.|||.....|..|.:.|      |.
  Fly   692 -SSSTSLQAPPSQHGSGSGGSGGQTPGSKKDKPSYNCLLCPKSYRKRKSLLDHYKMHPGYCHDCG 755

  Fly   370 SAEGNQVKKV-------------FSCKNCDKTYVSLGALKMHIRTH------TLPCK-------- 407
            ...||.::::             |.|:.|.::|........|:.:|      |.||.        
  Fly   756 QRNGNTLEEIIHHNRTMHVKEFPFVCETCGESYSRKQQFHAHVESHNKKEIKTFPCGECGLKFPQ 820

  Fly   408 ------------------CPICGKAF-SRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHM 453
                              |.:||:.| |:..|.|..||.|..:..|.|..|:..|..::||..|:
  Fly   821 KKLQQHFEETGHKADGAICEVCGEEFQSKNALYQHIIRVHKRDNFFECHICHNRFTLKANLERHV 885

  Fly   454 QTHSDVKK-YSCPTCTKSFSRMSLLAKHLQ------SGCQTEQSGGPSGSGGGFDQQQLQQHLQV 511
            |.|:::|: |.|..|..|:.....|.:|..      |.|:....|...||.     :.||:||..
  Fly   886 QLHTEIKRPYVCDLCGSSYFTYPALKEHYSNAHVDVSECKCTLCGKRFGSA-----KSLQRHLPS 945

  Fly   512 YEEGHNPHQLYY 523
            :.| ..||...|
  Fly   946 HSE-ERPHCCNY 956

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 6/26 (23%)
C2H2 Zn finger 317..334 CDD:275368 5/36 (14%)
zf-C2H2 345..367 CDD:278523 8/21 (38%)
C2H2 Zn finger 347..367 CDD:275368 7/19 (37%)
PHA00732 379..>417 CDD:177300 13/83 (16%)
C2H2 Zn finger 382..402 CDD:275368 4/19 (21%)
zf-C2H2_8 405..482 CDD:292531 28/104 (27%)
zf-C2H2 406..428 CDD:278523 10/48 (21%)
C2H2 Zn finger 408..428 CDD:275368 9/20 (45%)
zf-H2C2_2 421..444 CDD:290200 7/22 (32%)
zf-C2H2 434..456 CDD:278523 8/21 (38%)
C2H2 Zn finger 436..456 CDD:275368 7/19 (37%)
zf-H2C2_2 448..473 CDD:290200 10/25 (40%)
C2H2 Zn finger 464..481 CDD:275368 4/16 (25%)
CG10543NP_001369100.1 C2H2 Zn finger 727..747 CDD:275368 7/19 (37%)
C2H2 Zn finger 751..773 CDD:275368 3/21 (14%)
C2H2 Zn finger 781..801 CDD:275368 4/19 (21%)
PHA00733 <804..860 CDD:177301 12/55 (22%)
C2H2 Zn finger 811..827 CDD:275368 1/15 (7%)
C2H2 Zn finger 839..860 CDD:275368 9/20 (45%)
C2H2 Zn finger 868..888 CDD:275368 7/19 (37%)
C2H2 Zn finger 897..913 CDD:275368 4/15 (27%)
C2H2 Zn finger 926..946 CDD:275368 7/24 (29%)
C2H2 Zn finger 954..975 CDD:275368 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.