DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wor and CG11906

DIOPT Version :9

Sequence 1:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_611402.2 Gene:CG11906 / 37209 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster


Alignment Length:606 Identity:118/606 - (19%)
Similarity:179/606 - (29%) Gaps:178/606 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MVEESSPEDHLSHDEGPVDLSVASAAVPMEPHWMAKSEPEPQPV------PTELRRRFDAAMNQT 75
            |.:.::|:...|...|...:...:.....|.|..|:.|.|....      ..:.....|...|..
  Fly     1 MQDATAPDPEPSSTNGNCSVEHDNRQDQDENHVGAEREAEANDANCTVCGAAKASALLDLRSNHV 65

  Fly    76 KEQLARRIWEETREIARAFPDVFTRE---------EIAKS-------LARLGYGEFELPPEEEVM 124
            .::...|.|:...::.|:.......|         |:.:|       |.|.| ||     ..:|.
  Fly    66 MQRRLSRDWKIHADVIRSTLKAICVECVCKLNMHSEVTRSLMQRMQRLQRSG-GE-----TTKVT 124

  Fly   125 EPEPEPEQHLPLRYTRDASPTIIKAEPSDEEQFPLRNYNNNLLKSIAEYEDCMKMQNIKEEIPPI 189
            .....|.||.|.....:.|.|:|:   |.||.       .:..:|:.....|..::....:.|  
  Fly   125 TTTTSPSQHSPPIADAEVSTTLIE---SQEEV-------AHSGQSVRSRSSCSVLEVYLAQQP-- 177

  Fly   190 PSPQLFYPPPTPLAEPEDLSVTQRRVLSENMNLQNVARALLSMQHMAPQH----------APPPI 244
                  |.|.....|.:.....:.|.   .:......||.....:.| ||          .|.|.
  Fly   178 ------YSPSAKETEEKHAEGWKWRT---RLECHECGRAYFRRDYYA-QHLRRCSKTRRKQPRPS 232

  Fly   245 D-----MEEDQENQDINQLKIKSSNDLYYQCQQCNKCYATYAGLV--------KHQQTH------ 290
            .     :.|...:::.....|:||. :||    |..|.|.:..|:        ||||.:      
  Fly   233 RVKCRVLNEASYDEEAPSRAIRSSR-IYY----CRHCDAEFETLISKRQHERMKHQQRYPCDLCE 292

  Fly   291 -----AYESTEYKIIRSQPGGSGAIVDQTEFCTDQASALIQAANVASAQSMQKPVGVPRYHCQDC 350
                 .||...:..|......:.|||:|.|     |...:..:.|..|.||       |...:.|
  Fly   293 AQLDTKYEWEMHHTICQAKQEALAIVEQQE-----AGQTVMTSRVPRACSM-------RSRSRAC 345

  Fly   351 GKSYSTY---------------SG-----------------------LSKHQQFHCPSAEGN--- 374
            .:::..|               ||                       :..|.:.:..|| ||   
  Fly   346 SEAWDRYDMDEEEEDEEDEEIESGGEELEEGEEDAMYARRMNFTGDWIVNHSRSNSNSA-GNLSL 409

  Fly   375 ---QVKKVFSCKNCDKTY--VSLGALKMHIRTHTLPCKCPICGKAFSRPWLLQGH-IRTHTGEKP 433
               ....|.:....||.|  ..|..||..:|..:..|..|.||........|..| ...|.....
  Fly   410 LYGDYGMVETHMTTDKEYDLYLLDLLKTQVRLKSFTCFTPDCGYQTDTLVALMKHDYMEHWKMSW 474

  Fly   434 FSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAKHLQSGCQTEQSGGPSGSGG 498
            |.|..|...|..:..|..||...:. ..|.|..|.:.|..                         
  Fly   475 FYCHKCGDVFTSKVFLDYHMHLQNR-GLYICHKCREEFEL------------------------- 513

  Fly   499 GFDQQQLQQHLQVYEEGHNPH 519
               |.||.:|.|::.:|.|.|
  Fly   514 ---QHQLDRHFQLHRKGINYH 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 8/27 (30%)
C2H2 Zn finger 317..334 CDD:275368 2/16 (13%)
zf-C2H2 345..367 CDD:278523 5/59 (8%)
C2H2 Zn finger 347..367 CDD:275368 5/57 (9%)
PHA00732 379..>417 CDD:177300 12/39 (31%)
C2H2 Zn finger 382..402 CDD:275368 7/21 (33%)
zf-C2H2_8 405..482 CDD:292531 18/77 (23%)
zf-C2H2 406..428 CDD:278523 6/22 (27%)
C2H2 Zn finger 408..428 CDD:275368 5/20 (25%)
zf-H2C2_2 421..444 CDD:290200 6/23 (26%)
zf-C2H2 434..456 CDD:278523 7/21 (33%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)
zf-H2C2_2 448..473 CDD:290200 7/24 (29%)
C2H2 Zn finger 464..481 CDD:275368 3/16 (19%)
CG11906NP_611402.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457210
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.