DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wor and CG15446

DIOPT Version :9

Sequence 1:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_608430.2 Gene:CG15446 / 33088 FlyBaseID:FBgn0031155 Length:373 Species:Drosophila melanogaster


Alignment Length:363 Identity:66/363 - (18%)
Similarity:124/363 - (34%) Gaps:104/363 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLKYSRCPLKKRPIMVEESSPED--HLSHDEGPVDLSVASAAVPMEPHWMAKSEPEPQPVPTELR 65
            ::|:...|:.:||:...:.:.:.  .|.:|.                 |:: |:..|..|..|:.
  Fly    41 EVKHPNNPVNRRPVSYRQMANQSRRQLENDS-----------------WLS-SDRLPMMVRHEIE 87

  Fly    66 RRFDAAMNQTKEQLARRIWEETREIARAF-----------PDVFTREEIAKSLARLGYGEFELPP 119
            .|       .|:||..:...||  ....|           |...|...:|...||...|..:.|.
  Fly    88 TR-------NKKQLMSKYNAET--ATHVFSHNGGPRRGRPPSAATAARMASEFARQVGGISQSPT 143

  Fly   120 --------EEEVMEPEPEPEQHLPLRYTRDASPTIIKAEPSDEE-----QFPLRNYNNNLLKSIA 171
                    |:.||:|:.:....:|   .:.|.....|:||..||     :..:....:|     |
  Fly   144 IEDEGKSGEQSVMQPKSKKANKMP---DKVADKLATKSEPKSEESNVPVKIKVEGVEHN-----A 200

  Fly   172 EYEDCMKMQNIKEE-------IPPIPSPQLFYPPPTPLAEPEDLSVTQRRVLSENMNLQNVARAL 229
            |......|.|..:.       ||.:.|    :|.|   ....|::.|::.....|....::..::
  Fly   201 EGSQSDSMVNTNQGFTTNRNFIPILSS----FPNP---YRNMDVTWTEQFNALSNQYYNHIMNSI 258

  Fly   230 LSMQHMAPQH----APPPI-------------------DMEEDQENQDINQLKIKSSNDL----- 266
            .|:..:.|.:    |.|||                   .::..:||.|..:...|...:.     
  Fly   259 SSLSQIQPLNSTPSANPPIFGANPMVMGRHPPFSVFSCPLDYCKENFDSRRAMYKHQRETGHHNW 323

  Fly   267 YYQCQQCNKCYATYAGLVKHQQTHAYESTEYKIIRSQP 304
            .:.|.:|.:.:.| :|.::....:|.....:|...::|
  Fly   324 PHNCSKCGQVFRT-SGFMRMHSVNACARNLHKFKITKP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 4/19 (21%)
C2H2 Zn finger 317..334 CDD:275368
zf-C2H2 345..367 CDD:278523
C2H2 Zn finger 347..367 CDD:275368
PHA00732 379..>417 CDD:177300
C2H2 Zn finger 382..402 CDD:275368
zf-C2H2_8 405..482 CDD:292531
zf-C2H2 406..428 CDD:278523
C2H2 Zn finger 408..428 CDD:275368
zf-H2C2_2 421..444 CDD:290200
zf-C2H2 434..456 CDD:278523
C2H2 Zn finger 436..456 CDD:275368
zf-H2C2_2 448..473 CDD:290200
C2H2 Zn finger 464..481 CDD:275368
CG15446NP_608430.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.