Sequence 1: | NP_476601.1 | Gene: | wor / 34906 | FlyBaseID: | FBgn0001983 | Length: | 548 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572446.2 | Gene: | CG2120 / 31737 | FlyBaseID: | FBgn0030005 | Length: | 315 | Species: | Drosophila melanogaster |
Alignment Length: | 263 | Identity: | 64/263 - (24%) |
---|---|---|---|
Similarity: | 87/263 - (33%) | Gaps: | 80/263 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 324 LIQAANVASAQ---------SMQKPVGVPR----------YHCQDCGKSYSTYSGLSKHQQFHCP 369
Fly 370 SAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTL--PCKCPICGKAFSRPWLLQGHIRTHTGEK 432
Fly 433 P--------------------------------------------------FSCQHCNRAFADRS 447
Fly 448 NLRAHMQTHSDVKKYSC--PTCTKSFSRMSLLAKHLQSGCQTEQSGGPSGSGGGFDQQQLQQHLQ 510
Fly 511 VYE 513 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
wor | NP_476601.1 | C2H2 Zn finger | 270..290 | CDD:275368 | |
C2H2 Zn finger | 317..334 | CDD:275368 | 3/9 (33%) | ||
zf-C2H2 | 345..367 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 347..367 | CDD:275368 | 5/19 (26%) | ||
PHA00732 | 379..>417 | CDD:177300 | 17/39 (44%) | ||
C2H2 Zn finger | 382..402 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2_8 | 405..482 | CDD:292531 | 33/128 (26%) | ||
zf-C2H2 | 406..428 | CDD:278523 | 10/21 (48%) | ||
C2H2 Zn finger | 408..428 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 421..444 | CDD:290200 | 13/72 (18%) | ||
zf-C2H2 | 434..456 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 436..456 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 448..473 | CDD:290200 | 8/26 (31%) | ||
C2H2 Zn finger | 464..481 | CDD:275368 | 7/18 (39%) | ||
CG2120 | NP_572446.2 | C2H2 Zn finger | 101..121 | CDD:275368 | 5/19 (26%) |
zf-H2C2_2 | 113..138 | CDD:290200 | 7/31 (23%) | ||
C2H2 Zn finger | 129..149 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 142..166 | CDD:290200 | 13/23 (57%) | ||
COG5048 | 151..>264 | CDD:227381 | 25/112 (22%) | ||
C2H2 Zn finger | 157..177 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 185..206 | CDD:275368 | 0/20 (0%) | ||
C2H2 Zn finger | 235..255 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 263..285 | CDD:275368 | 8/21 (38%) | ||
C2H2 Zn finger | 293..313 | CDD:275368 | 4/19 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24409 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |