DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wor and CG2120

DIOPT Version :9

Sequence 1:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:263 Identity:64/263 - (24%)
Similarity:87/263 - (33%) Gaps:80/263 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 LIQAANVASAQ---------SMQKPVGVPR----------YHCQDCGKSYSTYSGLSKHQQFHCP 369
            |::..|.|..|         .|.||...|.          :.|..|.:.:|....|..|:..|..
  Fly    59 LLELVNGALQQRNTTEHKPTDMCKPKRTPTTKRHRTTGKDHTCDICDRRFSEAYNLRIHKMTHTD 123

  Fly   370 SAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTL--PCKCPICGKAFSRPWLLQGHIRTHTGEK 432
                   :|...|..|.|.:..|..|::|..|||.  |.||.||||.|.....|..|.|.|||||
  Fly   124 -------EKPHVCVECGKGFRQLNKLRIHAVTHTAERPHKCDICGKGFRYANYLTVHRRLHTGEK 181

  Fly   433 P--------------------------------------------------FSCQHCNRAFADRS 447
            |                                                  |:|..|:|...|:.
  Fly   182 PYPCLATDCHLSFHSIHARRIHTKLRHAAQTDPDPEHPLAEQEQRDTSALSFTCPVCSRVLTDQC 246

  Fly   448 NLRAHMQTHSDVKKYSC--PTCTKSFSRMSLLAKHLQSGCQTEQSGGPSGSGGGFDQQQLQQHLQ 510
            .|..|::.|.:.:.:.|  |.|.|.|...|.|..|..:..|......|........:...:|||:
  Fly   247 YLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIAHTQQRPFACPLCPARFLRKSNHKQHLK 311

  Fly   511 VYE 513
            |:|
  Fly   312 VHE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368
C2H2 Zn finger 317..334 CDD:275368 3/9 (33%)
zf-C2H2 345..367 CDD:278523 5/21 (24%)
C2H2 Zn finger 347..367 CDD:275368 5/19 (26%)
PHA00732 379..>417 CDD:177300 17/39 (44%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
zf-C2H2_8 405..482 CDD:292531 33/128 (26%)
zf-C2H2 406..428 CDD:278523 10/21 (48%)
C2H2 Zn finger 408..428 CDD:275368 9/19 (47%)
zf-H2C2_2 421..444 CDD:290200 13/72 (18%)
zf-C2H2 434..456 CDD:278523 7/21 (33%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)
zf-H2C2_2 448..473 CDD:290200 8/26 (31%)
C2H2 Zn finger 464..481 CDD:275368 7/18 (39%)
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 5/19 (26%)
zf-H2C2_2 113..138 CDD:290200 7/31 (23%)
C2H2 Zn finger 129..149 CDD:275368 6/19 (32%)
zf-H2C2_2 142..166 CDD:290200 13/23 (57%)
COG5048 151..>264 CDD:227381 25/112 (22%)
C2H2 Zn finger 157..177 CDD:275368 9/19 (47%)
C2H2 Zn finger 185..206 CDD:275368 0/20 (0%)
C2H2 Zn finger 235..255 CDD:275368 6/19 (32%)
C2H2 Zn finger 263..285 CDD:275368 8/21 (38%)
C2H2 Zn finger 293..313 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.