DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment wor and Snai3

DIOPT Version :9

Sequence 1:	NP_476601.1	Gene:	wor / 34906	FlyBaseID:	FBgn0001983	Length:	548	Species:	Drosophila melanogaster
Sequence 2:	XP_006531137.1	Gene:	Snai3 / 30927	MGIID:	1353563	Length:	327	Species:	Mus musculus

Alignment Length:	140	Identity:	83/140 - (59%)
Similarity:	100/140 - (71%)	Gaps:	10/140 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   345 YHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCP 409
            :.|..|.:.|.|.:||::|||.||....|    :.|:|:.|||.|.||||||||||||||||.|.
Mouse   147 FECIHCHRPYHTLAGLARHQQLHCHLPTG----RAFTCRYCDKEYASLGALKMHIRTHTLPCICK 207

  Fly   410 ICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYS------CPTCT 468
            :|||||||||||||||||||||||::|.||:||||||||||||:|||...|||.      .|...
Mouse   208 VCGKAFSRPWLLQGHIRTHTGEKPYTCSHCSRAFADRSNLRAHLQTHVGTKKYRTGPSSLLPVSC 272

  Fly   469 KSFSRMSLLA 478
            ::.::.||.|
Mouse   273 QNQAQWSLRA 282

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
wor	NP_476601.1	C2H2 Zn finger	270..290	CDD:275368
		C2H2 Zn finger	317..334	CDD:275368
		zf-C2H2	345..367	CDD:278523	9/21 (43%)
		C2H2 Zn finger	347..367	CDD:275368	9/19 (47%)
		PHA00732	379..>417	CDD:177300	28/37 (76%)
		C2H2 Zn finger	382..402	CDD:275368	15/19 (79%)
		zf-C2H2_8	405..482	CDD:292531	51/80 (64%)
		zf-C2H2	406..428	CDD:278523	18/21 (86%)
		C2H2 Zn finger	408..428	CDD:275368	17/19 (89%)
		zf-H2C2_2	421..444	CDD:290200	18/22 (82%)
		zf-C2H2	434..456	CDD:278523	16/21 (76%)
		C2H2 Zn finger	436..456	CDD:275368	16/19 (84%)
		zf-H2C2_2	448..473	CDD:290200	12/30 (40%)
		C2H2 Zn finger	464..481	CDD:275368	4/15 (27%)
Snai3	XP_006531137.1	C2H2 Zn finger	149..169	CDD:275368	9/19 (47%)
		C2H2 Zn finger	180..200	CDD:275368	15/19 (79%)
		C2H2 Zn finger	206..226	CDD:275368	17/19 (89%)
		zf-C2H2	206..226	CDD:333835	17/19 (89%)
		zf-H2C2_2	219..242	CDD:372612	18/22 (82%)
		zf-C2H2	232..254	CDD:333835	16/21 (76%)
		C2H2 Zn finger	234..254	CDD:275368	16/19 (84%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167850213
Domainoid	1	1.000	50	1.000	Domainoid score	I11573
eggNOG	1	0.900	-	-		E1_KOG2462
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	1	1.000	-	-		mtm8700
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X955
SwiftOrtho	1	1.000	-	-
TreeFam	1	0.960	-	-
	8	7.700