DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment wor and snai1a

DIOPT Version :9

Sequence 1:	NP_476601.1	Gene:	wor / 34906	FlyBaseID:	FBgn0001983	Length:	548	Species:	Drosophila melanogaster
Sequence 2:	NP_001300628.1	Gene:	snai1a / 30273	ZFINID:	ZDB-GENE-990415-255	Length:	260	Species:	Danio rerio

Alignment Length:	141	Identity:	88/141 - (62%)
Similarity:	105/141 - (74%)	Gaps:	0/141 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   345 YHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCP 409
            ||.|...:...:....:..::....:|.....:..|.||:|.|.|.||||||||||:|||||.||
Zfish   112 YHPQQTSRPRRSNKSRAGQREDKSEAAVTAASRPAFFCKHCPKEYNSLGALKMHIRSHTLPCVCP 176

  Fly   410 ICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRM 474
            .|||||||||||:|||||||||:||||.|||||||||||||||:|||:|||||.|.||:::||||
Zfish   177 TCGKAFSRPWLLRGHIRTHTGERPFSCPHCNRAFADRSNLRAHLQTHADVKKYQCSTCSRTFSRM 241

  Fly   475 SLLAKHLQSGC 485
            |||.||..:||
Zfish   242 SLLQKHSAAGC 252

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
wor	NP_476601.1	C2H2 Zn finger	270..290	CDD:275368
		C2H2 Zn finger	317..334	CDD:275368
		zf-C2H2	345..367	CDD:278523	3/21 (14%)
		C2H2 Zn finger	347..367	CDD:275368	1/19 (5%)
		PHA00732	379..>417	CDD:177300	28/37 (76%)
		C2H2 Zn finger	382..402	CDD:275368	15/19 (79%)
		zf-C2H2_8	405..482	CDD:292531	63/76 (83%)
		zf-C2H2	406..428	CDD:278523	18/21 (86%)
		C2H2 Zn finger	408..428	CDD:275368	17/19 (89%)
		zf-H2C2_2	421..444	CDD:290200	19/22 (86%)
		zf-C2H2	434..456	CDD:278523	19/21 (90%)
		C2H2 Zn finger	436..456	CDD:275368	17/19 (89%)
		zf-H2C2_2	448..473	CDD:290200	17/24 (71%)
		C2H2 Zn finger	464..481	CDD:275368	11/16 (69%)
snai1a	NP_001300628.1	C2H2 Zn finger	149..169	CDD:275368	15/19 (79%)
		COG5048	<170..>244	CDD:227381	61/73 (84%)
		zf-C2H2	173..195	CDD:278523	18/21 (86%)
		C2H2 Zn finger	175..195	CDD:275368	17/19 (89%)
		zf-H2C2_2	188..211	CDD:290200	19/22 (86%)
		zf-C2H2	201..223	CDD:278523	19/21 (90%)
		C2H2 Zn finger	203..223	CDD:275368	17/19 (89%)
		C2H2 Zn finger	231..247	CDD:275368	10/15 (67%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	52	1.000	Domainoid score	I11461
eggNOG	1	0.900	-	-		E1_KOG2462
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0012001
OrthoInspector	1	1.000	-	-		mtm6484
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X955
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
ZFIN	0	0.000	Not matched by this tool.
	8	7.770