DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment wor and Snai2

DIOPT Version :9

Sequence 1:	NP_476601.1	Gene:	wor / 34906	FlyBaseID:	FBgn0001983	Length:	548	Species:	Drosophila melanogaster
Sequence 2:	NP_037167.1	Gene:	Snai2 / 25554	RGDID:	3722	Length:	268	Species:	Rattus norvegicus

Alignment Length:	142	Identity:	108/142 - (76%)
Similarity:	120/142 - (84%)	Gaps:	4/142 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   344 RYHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKC 408
            ::.|..|.|:|||:|||:||:|.||.:    |.:|.||||.|||.||||||||||||||||||.|
  Rat   127 KFQCNLCNKTYSTFSGLAKHKQLHCDA----QARKSFSCKYCDKEYVSLGALKMHIRTHTLPCVC 187

  Fly   409 PICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSR 473
            .|||||||||||||||||||||||||||.|||||||||||||||:|||||||||.|..|:|:|||
  Rat   188 KICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSR 252

  Fly   474 MSLLAKHLQSGC 485
            ||||.||.:|||
  Rat   253 MSLLHKHEESGC 264

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
wor	NP_476601.1	C2H2 Zn finger	270..290	CDD:275368
		C2H2 Zn finger	317..334	CDD:275368
		zf-C2H2	345..367	CDD:278523	12/21 (57%)
		C2H2 Zn finger	347..367	CDD:275368	12/19 (63%)
		PHA00732	379..>417	CDD:177300	32/37 (86%)
		C2H2 Zn finger	382..402	CDD:275368	17/19 (89%)
		zf-C2H2_8	405..482	CDD:292531	66/76 (87%)
		zf-C2H2	406..428	CDD:278523	19/21 (90%)
		C2H2 Zn finger	408..428	CDD:275368	18/19 (95%)
		zf-H2C2_2	421..444	CDD:290200	21/22 (95%)
		zf-C2H2	434..456	CDD:278523	19/21 (90%)
		C2H2 Zn finger	436..456	CDD:275368	17/19 (89%)
		zf-H2C2_2	448..473	CDD:290200	18/24 (75%)
		C2H2 Zn finger	464..481	CDD:275368	11/16 (69%)
Snai2	NP_037167.1	SNAG domain. /evidence=ECO:0000250	1..20
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	84..116
		SFP1	<86..182	CDD:227516	36/58 (62%)
		C2H2 Zn finger	130..150	CDD:275370	12/19 (63%)
		C2H2 Zn finger	161..181	CDD:275368	17/19 (89%)
		C2H2 Zn finger	187..207	CDD:275368	18/19 (95%)
		zf-H2C2_2	200..223	CDD:404364	21/22 (95%)
		zf-C2H2	213..235	CDD:395048	19/21 (90%)
		C2H2 Zn finger	215..235	CDD:275368	17/19 (89%)
		C2H2 Zn finger	243..259	CDD:275368	10/15 (67%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	52	1.000	Domainoid score	I11165
eggNOG	1	0.900	-	-		E1_KOG2462
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	1	1.000	-	-		mtm8936
orthoMCL	1	0.900	-	-		OOG6_107394
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X955
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	7	6.710