DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment wor and scrt-1

DIOPT Version :9

Sequence 1:	NP_476601.1	Gene:	wor / 34906	FlyBaseID:	FBgn0001983	Length:	548	Species:	Drosophila melanogaster
Sequence 2:	NP_491001.2	Gene:	scrt-1 / 183848	WormBaseID:	WBGene00016948	Length:	178	Species:	Caenorhabditis elegans

Alignment Length:	133	Identity:	61/133 - (45%)
Similarity:	76/133 - (57%)	Gaps:	32/133 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   353 SYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCPICGKAFSR 417
            ||||.|           |.:|.|:|                     ..|.:..|:|.:|||.|||
Worm    73 SYSTPS-----------SPDGKQLK---------------------FATCSPVCQCKVCGKRFSR 105

  Fly   418 PWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAKHLQ 482
            .||||||:|||||||||.|:.|::.|||:||||||:||||..|.:.||.|.|||:..|.|:||.:
Worm   106 QWLLQGHLRTHTGEKPFQCEICSKRFADKSNLRAHIQTHSGTKPHKCPRCGKSFALKSYLSKHEE 170

  Fly   483 SGC 485
            |.|
Worm   171 SKC 173

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
wor	NP_476601.1	C2H2 Zn finger	270..290	CDD:275368
		C2H2 Zn finger	317..334	CDD:275368
		zf-C2H2	345..367	CDD:278523	5/13 (38%)
		C2H2 Zn finger	347..367	CDD:275368	5/13 (38%)
		PHA00732	379..>417	CDD:177300	7/37 (19%)
		C2H2 Zn finger	382..402	CDD:275368	0/19 (0%)
		zf-C2H2_8	405..482	CDD:292531	49/76 (64%)
		zf-C2H2	406..428	CDD:278523	15/21 (71%)
		C2H2 Zn finger	408..428	CDD:275368	14/19 (74%)
		zf-H2C2_2	421..444	CDD:290200	15/22 (68%)
		zf-C2H2	434..456	CDD:278523	13/21 (62%)
		C2H2 Zn finger	436..456	CDD:275368	12/19 (63%)
		zf-H2C2_2	448..473	CDD:290200	16/24 (67%)
		C2H2 Zn finger	464..481	CDD:275368	9/16 (56%)
scrt-1	NP_491001.2	zf-C2H2	94..116	CDD:278523	15/21 (71%)
		C2H2 Zn finger	96..116	CDD:275368	14/19 (74%)
		zf-H2C2_2	109..132	CDD:290200	15/22 (68%)
		C2H2 Zn finger	124..144	CDD:275368	12/19 (63%)
		zf-H2C2_2	136..160	CDD:290200	15/23 (65%)
		C2H2 Zn finger	152..168	CDD:275368	8/15 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2462
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810