| Sequence 1: | NP_476601.1 | Gene: | wor / 34906 | FlyBaseID: | FBgn0001983 | Length: | 548 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_570963.1 | Gene: | Scrt1 / 170729 | MGIID: | 2176606 | Length: | 348 | Species: | Mus musculus |
| Alignment Length: | 196 | Identity: | 95/196 - (48%) |
|---|---|---|---|
| Similarity: | 117/196 - (59%) | Gaps: | 20/196 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 304 PG----GSGAIVDQTEFCTDQASALIQAANVASAQSMQKPVGVPRYHCQDCGKSYSTYSGLSKHQ 364
Fly 365 QFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCPICGKAFSRPWLLQGHIRTHT 429
Fly 430 GEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAKHLQSGCQTEQSGGPS 494
Fly 495 G 495 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| wor | NP_476601.1 | C2H2 Zn finger | 270..290 | CDD:275368 | |
| C2H2 Zn finger | 317..334 | CDD:275368 | 2/16 (13%) | ||
| zf-C2H2 | 345..367 | CDD:278523 | 11/21 (52%) | ||
| C2H2 Zn finger | 347..367 | CDD:275368 | 11/19 (58%) | ||
| PHA00732 | 379..>417 | CDD:177300 | 19/37 (51%) | ||
| C2H2 Zn finger | 382..402 | CDD:275368 | 9/19 (47%) | ||
| zf-C2H2_8 | 405..482 | CDD:292531 | 53/76 (70%) | ||
| zf-C2H2 | 406..428 | CDD:278523 | 17/21 (81%) | ||
| C2H2 Zn finger | 408..428 | CDD:275368 | 16/19 (84%) | ||
| zf-H2C2_2 | 421..444 | CDD:290200 | 16/22 (73%) | ||
| zf-C2H2 | 434..456 | CDD:278523 | 17/21 (81%) | ||
| C2H2 Zn finger | 436..456 | CDD:275368 | 16/19 (84%) | ||
| zf-H2C2_2 | 448..473 | CDD:290200 | 16/24 (67%) | ||
| C2H2 Zn finger | 464..481 | CDD:275368 | 8/16 (50%) | ||
| Scrt1 | NP_570963.1 | SNAG domain. /evidence=ECO:0000250 | 1..20 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 130..190 | 10/43 (23%) | |||
| zf-C2H2 | 191..213 | CDD:278523 | 11/21 (52%) | ||
| C2H2 Zn finger | 193..213 | CDD:275368 | 11/19 (58%) | ||
| C2H2 Zn finger | 224..241 | CDD:275371 | 8/16 (50%) | ||
| COG5048 | <245..>313 | CDD:227381 | 48/67 (72%) | ||
| zf-C2H2 | 248..270 | CDD:278523 | 17/21 (81%) | ||
| C2H2 Zn finger | 250..270 | CDD:275368 | 16/19 (84%) | ||
| zf-H2C2_2 | 263..286 | CDD:290200 | 16/22 (73%) | ||
| C2H2 Zn finger | 278..298 | CDD:275368 | 16/19 (84%) | ||
| zf-C2H2 | 278..298 | CDD:278523 | 16/19 (84%) | ||
| zf-H2C2_2 | 290..314 | CDD:290200 | 15/23 (65%) | ||
| C2H2 Zn finger | 306..322 | CDD:275368 | 7/15 (47%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2462 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 176 | 1.000 | Inparanoid score | I4034 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.860 | |||||