DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wor and Snai1

DIOPT Version :9

Sequence 1:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_446257.1 Gene:Snai1 / 116490 RGDID:620758 Length:264 Species:Rattus norvegicus


Alignment Length:144 Identity:94/144 - (65%)
Similarity:111/144 - (77%) Gaps:6/144 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 KSYSTYSGLSK--HQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCPICGKA 414
            :::..:.||.:  .|......|:..|.:|.|:||.|:|.|:||||||||||:|||||.|..||||
  Rat   124 EAFIAFPGLGQLPKQLARLSVAKDPQSRKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCTTCGKA 188

  Fly   415 FSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAK 479
            ||||||||||:|||||||||||.|||||||||||||||:|||||||:|.|..|.::|||||||.|
  Rat   189 FSRPWLLQGHVRTHTGEKPFSCSHCNRAFADRSNLRAHLQTHSDVKRYQCQACARTFSRMSLLHK 253

  Fly   480 HLQSGCQTEQSGGP 493
            |.:|||    ||||
  Rat   254 HQESGC----SGGP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368
C2H2 Zn finger 317..334 CDD:275368
zf-C2H2 345..367 CDD:278523 3/16 (19%)
C2H2 Zn finger 347..367 CDD:275368 3/16 (19%)
PHA00732 379..>417 CDD:177300 27/37 (73%)
C2H2 Zn finger 382..402 CDD:275368 15/19 (79%)
zf-C2H2_8 405..482 CDD:292531 62/76 (82%)
zf-C2H2 406..428 CDD:278523 17/21 (81%)
C2H2 Zn finger 408..428 CDD:275368 16/19 (84%)
zf-H2C2_2 421..444 CDD:290200 20/22 (91%)
zf-C2H2 434..456 CDD:278523 19/21 (90%)
C2H2 Zn finger 436..456 CDD:275368 17/19 (89%)
zf-H2C2_2 448..473 CDD:290200 16/24 (67%)
C2H2 Zn finger 464..481 CDD:275368 10/16 (63%)
Snai1NP_446257.1 C2H2 Zn finger 156..176 CDD:275368 15/19 (79%)
COG5048 <177..>253 CDD:227381 62/75 (83%)
zf-C2H2 180..202 CDD:278523 17/21 (81%)
C2H2 Zn finger 182..202 CDD:275368 16/19 (84%)
zf-H2C2_2 195..218 CDD:290200 20/22 (91%)
zf-C2H2 208..230 CDD:278523 19/21 (90%)
C2H2 Zn finger 210..230 CDD:275368 17/19 (89%)
C2H2 Zn finger 238..255 CDD:275368 10/16 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11165
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012001
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X955
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.770

Return to query results.
Submit another query.