Sequence 1: | NP_476601.1 | Gene: | wor / 34906 | FlyBaseID: | FBgn0001983 | Length: | 548 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005171139.1 | Gene: | LOC101886047 / 101886047 | -ID: | - | Length: | 483 | Species: | Danio rerio |
Alignment Length: | 349 | Identity: | 95/349 - (27%) |
---|---|---|---|
Similarity: | 135/349 - (38%) | Gaps: | 101/349 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 177 MKMQNIKEEIPPIPSPQLFYPPPTPLAEPEDLSVTQRRVLSENMNLQNVARALLSMQHMAPQHAP 241
Fly 242 PPIDMEEDQENQDIN-------------QLKIKSSNDLYYQCQQCNKCYATYAGLVKHQQTHAYE 293
Fly 294 STEYKIIRSQPGGSGAIVDQTEFCTDQASALIQAANVASAQSMQKPVGVPRYHCQDCGKSYSTYS 358
Fly 359 GLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHT--LPCKCPICGKAFSRPWLL 421
Fly 422 QGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCP--------------------- 465
Fly 466 -------TCTKSFSRMSLLAKHLQ 482 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
wor | NP_476601.1 | C2H2 Zn finger | 270..290 | CDD:275368 | 6/19 (32%) |
C2H2 Zn finger | 317..334 | CDD:275368 | 4/16 (25%) | ||
zf-C2H2 | 345..367 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 347..367 | CDD:275368 | 5/19 (26%) | ||
PHA00732 | 379..>417 | CDD:177300 | 16/39 (41%) | ||
C2H2 Zn finger | 382..402 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2_8 | 405..482 | CDD:292531 | 38/104 (37%) | ||
zf-C2H2 | 406..428 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 408..428 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 421..444 | CDD:290200 | 11/22 (50%) | ||
zf-C2H2 | 434..456 | CDD:278523 | 11/21 (52%) | ||
C2H2 Zn finger | 436..456 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 448..473 | CDD:290200 | 15/52 (29%) | ||
C2H2 Zn finger | 464..481 | CDD:275368 | 9/44 (20%) | ||
LOC101886047 | XP_005171139.1 | Merozoite_SPAM | <4..98 | CDD:284533 | 26/123 (21%) |
COG5048 | 69..410 | CDD:227381 | 78/253 (31%) | ||
C2H2 Zn finger | 79..99 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 107..127 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 119..144 | CDD:290200 | 7/32 (22%) | ||
C2H2 Zn finger | 135..155 | CDD:275368 | 5/21 (24%) | ||
zf-H2C2_2 | 147..171 | CDD:290200 | 10/30 (33%) | ||
C2H2 Zn finger | 163..183 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 191..211 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 203..226 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 219..267 | CDD:275368 | 15/47 (32%) | ||
zf-H2C2_2 | 259..284 | CDD:290200 | 4/24 (17%) | ||
C2H2 Zn finger | 275..295 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 287..312 | CDD:290200 | 2/7 (29%) | ||
C2H2 Zn finger | 303..323 | CDD:275368 | |||
C2H2 Zn finger | 331..349 | CDD:275368 | |||
C2H2 Zn finger | 356..376 | CDD:275368 | |||
C2H2 Zn finger | 384..404 | CDD:275368 | |||
C2H2 Zn finger | 426..445 | CDD:275368 | |||
C2H2 Zn finger | 453..473 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |