Sequence 1: | NP_476600.1 | Gene: | esg / 34903 | FlyBaseID: | FBgn0001981 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001107073.1 | Gene: | scrt1a / 564658 | ZFINID: | ZDB-GENE-080219-30 | Length: | 279 | Species: | Danio rerio |
Alignment Length: | 256 | Identity: | 102/256 - (39%) |
---|---|---|---|
Similarity: | 137/256 - (53%) | Gaps: | 29/256 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 231 APISPAYSENSYYSMRSMTP-----ESSCSSSLPEDLSLK---HKNLNLNLNTSQPGEQAAAKTG 287
Fly 288 DMSPET-------------MPNASAKKDKNQP---PRYQCPDCQKSYSTFSGLTKHQQFHCPAAE 336
Fly 337 GNQVKKSFSCKDCDKTYVSLGALKMHIRTHTLPCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSCQ 401
Fly 402 HCHRAFADRSNLRAHLQTHSDIKKYSCTSCSKTFSRMSLLTKHSEGGCPGGSAGSSSSSEL 462 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
esg | NP_476600.1 | zf-C2H2 | 309..331 | CDD:278523 | 9/21 (43%) |
C2H2 Zn finger | 311..331 | CDD:275370 | 9/19 (47%) | ||
zf-C2H2 | 344..366 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 346..366 | CDD:275368 | 9/19 (47%) | ||
zf-C2H2 | 370..392 | CDD:278523 | 17/21 (81%) | ||
C2H2 Zn finger | 372..392 | CDD:275368 | 16/19 (84%) | ||
zf-H2C2_2 | 385..408 | CDD:290200 | 16/22 (73%) | ||
zf-C2H2 | 398..420 | CDD:278523 | 16/21 (76%) | ||
C2H2 Zn finger | 400..420 | CDD:275368 | 15/19 (79%) | ||
C2H2 Zn finger | 428..444 | CDD:275368 | 7/15 (47%) | ||
scrt1a | NP_001107073.1 | zf-C2H2 | 130..152 | CDD:278523 | 9/21 (43%) |
C2H2 Zn finger | 132..152 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 163..180 | CDD:275371 | 8/16 (50%) | ||
COG5048 | 187..>263 | CDD:227381 | 53/75 (71%) | ||
zf-C2H2 | 187..209 | CDD:278523 | 17/21 (81%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 16/19 (84%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 15/19 (79%) | ||
zf-C2H2 | 217..237 | CDD:278523 | 15/19 (79%) | ||
zf-H2C2_2 | 229..253 | CDD:290200 | 15/23 (65%) | ||
C2H2 Zn finger | 245..261 | CDD:275368 | 7/15 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |