DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esg and ZIPIC

DIOPT Version :9

Sequence 1:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster


Alignment Length:158 Identity:46/158 - (29%)
Similarity:71/158 - (44%) Gaps:29/158 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 PRYQCPDCQKSYSTFSGLTKH-------QQFHCPAAEGNQVKK--------------SFSCKDCD 350
            |.|.|..|.|:..::||...|       :||.||.......:|              .:.|..|.
  Fly   282 PGYVCDQCGKTLQSYSGFIGHLQNHEPVKQFACPVCPERFSRKFRLKHHMAWHSGETPYQCDVCS 346

  Fly   351 KTYVSLGALKMHIRTH---TLPCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSN 412
            |.:|...||..|...|   |...:|.:||........|:.|:|:|||:|||:|..|::.|:...|
  Fly   347 KRFVHKVALYKHKMIHDSETKRLECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCNKRFSQMYN 411

  Fly   413 LRAHLQTHSD-----IKKYSCTSCSKTF 435
            ::|||:.|..     .:::.|:.|:.||
  Fly   412 MKAHLREHESPGTNRHRRFHCSKCTHTF 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 8/28 (29%)
C2H2 Zn finger 311..331 CDD:275370 7/26 (27%)
zf-C2H2 344..366 CDD:278523 7/21 (33%)
C2H2 Zn finger 346..366 CDD:275368 7/19 (37%)
zf-C2H2 370..392 CDD:278523 6/21 (29%)
C2H2 Zn finger 372..392 CDD:275368 6/19 (32%)
zf-H2C2_2 385..408 CDD:290200 11/22 (50%)
zf-C2H2 398..420 CDD:278523 8/21 (38%)
C2H2 Zn finger 400..420 CDD:275368 7/19 (37%)
C2H2 Zn finger 428..444 CDD:275368 4/8 (50%)
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 3/19 (16%)
zf-H2C2_2 327..351 CDD:290200 3/23 (13%)
C2H2 Zn finger 342..391 CDD:275368 15/48 (31%)
zf-H2C2_2 383..408 CDD:290200 12/24 (50%)
C2H2 Zn finger 399..419 CDD:275368 7/19 (37%)
C2H2 Zn finger 432..449 CDD:275368 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.