DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esg and wdn

DIOPT Version :9

Sequence 1:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_476900.1 Gene:wdn / 43398 FlyBaseID:FBgn0005642 Length:869 Species:Drosophila melanogaster


Alignment Length:487 Identity:116/487 - (23%)
Similarity:186/487 - (38%) Gaps:149/487 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KKMEILEENPSEEL---INVSDCCEDEGVDVDHTDDEHIEE-------------EDEDVDVDVDS 94
            |:|:  ||.||::|   |...|.    |.......||.:..             :||.:|:|:  
  Fly     9 KRMK--EEAPSKKLPPKIYGGDA----GTPTKAAHDEILSSLLRINNFDSISSIKDESLDIDL-- 65

  Fly    95 DPNQTQAAALAAAAAVAAAAAASVVVPTPTYPKYPWNNFHMSPYTAEFYRTINQQGHQILPL--- 156
                         :|....::||:|           |...:|  :.:|:|.:::.......|   
  Fly    66 -------------SACVTISSASLV-----------NGNSLS--STDFWRVLDESAQNNTELNLS 104

  Fly   157 ----RGDLIAPSS---PSD-----------SLGSLSP-PPHHYLHG-----RASSVSPPMR--SE 195
                |.||.|.||   ||.           |:..|.| ||:.:.:.     .:|..|.|::  .|
  Fly   105 SDVCRDDLAATSSSTVPSTLTSDNHSSSEFSVTFLRPEPPNAFTNSPFKKTSSSGTSTPVKLSPE 169

  Fly   196 IIHRPIGVRQHRFLPYPQ---MPGYPSLGGYTHT----------HHHHAP--------------I 233
            .:|     :||: |..||   :...|.|...|..          ...|.|              :
  Fly   170 QLH-----QQHQ-LQMPQSQLLQRKPKLPAATAVRLKVFKEEPPEEKHPPEQVVTKVEVCESELL 228

  Fly   234 SPAY-------SENSYYSMRSMTPESSCSSS-LPEDLSLKHKNLNLN-LNTSQPGE----QAAAK 285
            .|::       |..|.....||.|.::..:. |..|.:..||.|:.| |....|.|    :|||.
  Fly   229 PPSFTIFQQAKSAESVADAASMPPPAASETKPLEVDPAPLHKCLDCNGLLLETPDEVAKHEAAAH 293

  Fly   286 TGDMSPETMPNASAKKDKNQPPRYQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCD 350
            ...::                  |:|.:||:.:...:||.||.:.|......:..||   |.||.
  Fly   294 RLRLT------------------YRCSECQREFELLAGLKKHLKTHRTEGRKDTWKK---CPDCG 337

  Fly   351 KTYVSLGALKMHIRTHT--LPCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNL 413
            |. :.||::.||.:.|:  ...:|::||:.|.:...|..|.|.|:.|||:.|..|.:.|.:||:|
  Fly   338 KC-LKLGSMWMHRKIHSDNKKYQCDICGQKFVQKINLTHHARIHSSEKPYECPECQKRFQERSHL 401

  Fly   414 RAHLQTHSDIKKYSCTSCSKTFSRMSLLTKHS 445
            :.|.:.|:..:.|.|..|.|.:.....|..|:
  Fly   402 QRHQKYHAQTRSYRCEKCGKMYKTERCLKVHN 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 8/21 (38%)
C2H2 Zn finger 311..331 CDD:275370 7/19 (37%)
zf-C2H2 344..366 CDD:278523 8/21 (38%)
C2H2 Zn finger 346..366 CDD:275368 8/19 (42%)
zf-C2H2 370..392 CDD:278523 7/21 (33%)
C2H2 Zn finger 372..392 CDD:275368 7/19 (37%)
zf-H2C2_2 385..408 CDD:290200 9/22 (41%)
zf-C2H2 398..420 CDD:278523 7/21 (33%)
C2H2 Zn finger 400..420 CDD:275368 7/19 (37%)
C2H2 Zn finger 428..444 CDD:275368 4/15 (27%)
wdnNP_476900.1 C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
RPB9 333..425 CDD:224510 32/92 (35%)
C2H2 Zn finger 333..352 CDD:275368 8/19 (42%)
zf-H2C2_2 344..369 CDD:290200 7/24 (29%)
zf-C2H2 358..380 CDD:278523 7/21 (33%)
C2H2 Zn finger 360..380 CDD:275368 7/19 (37%)
zf-H2C2_2 372..395 CDD:290200 9/22 (41%)
zf-C2H2 386..408 CDD:278523 7/21 (33%)
C2H2 Zn finger 388..436 CDD:275368 14/46 (30%)
zf-H2C2_2 400..425 CDD:290200 7/24 (29%)
C2H2 Zn finger 416..433 CDD:275368 4/16 (25%)
zf-H2C2_2 429..453 CDD:290200 2/5 (40%)
C2H2 Zn finger 444..464 CDD:275368
zf-H2C2_2 457..481 CDD:290200
C2H2 Zn finger 472..493 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.