DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esg and pad

DIOPT Version :9

Sequence 1:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_650534.2 Gene:pad / 41981 FlyBaseID:FBgn0038418 Length:924 Species:Drosophila melanogaster


Alignment Length:553 Identity:113/553 - (20%)
Similarity:180/553 - (32%) Gaps:172/553 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PQNHSN--TPNEPQDLCVKKMEILEENPSEELINVSDCCEDEGVDVDHTDDEHIEEEDEDVDVDV 92
            ||:.:|  :||:    |...:.|.:||..:::             |.|.|.:::          |
  Fly   345 PQSTTNLLSPNK----CFLPITIRDENSDQQI-------------VAHIDTKNL----------V 382

  Fly    93 DSDPNQTQAAALAAAAAVAAAAAASVVVPTPT-------------------------------YP 126
            .....|.|   :.....:|.|....::..|||                               .|
  Fly   383 LPTTYQVQ---MKLQPQLATADGQPIMQLTPTSIPATLQLTPQTLGNPGSAFQGTTVTQNQFLAP 444

  Fly   127 KYPWNNFH-----------MSPYTAEFYRTINQQGHQILPLRGDLIAPSSPSDSLGSLSPPPHHY 180
            :.|.....           .||:|:    |.|.|    |.:|.....|.:|:....|...|..  
  Fly   445 QQPLTQLPNTAQVTSQQIIRSPHTS----TTNSQ----LVIRNVTNIPPTPTTPTSSKKAPTF-- 499

  Fly   181 LHGRASSVSP---PMRSEIIHRPIG-----------------VRQHRFLPYPQM-----PGYPSL 220
                 .:.||   ||.|......:|                 :.|.:  |.||:     .|..:.
  Fly   500 -----KTPSPKQKPMPSPKSKTTVGPSSGGSNGTSTNEFKRLITQTK--PQPQVKQQQTAGLSAS 557

  Fly   221 GGYTHTHHHHAPISPAYSENSYYSMRSMTPESSCSSSLPEDLS-------LKHKNLNLNLNTSQP 278
            |..|.|..:.|.:....|..:.    :..|:...|...|...|       |..:|:.::..:.|.
  Fly   558 GAPTATSANQAAMQRLSSNTTI----TKVPKQPASLPAPAPTSNPAKLPMLNKQNITISRISMQT 618

  Fly   279 GEQAAAKTGDMSP---------------ETMP---NASAKKDKNQPPRYQCPDCQKSYSTFSGLT 325
            ..:|.:|....||               :..|   .|..||...:||..|....||   ..:...
  Fly   619 APKAQSKPSTTSPTPASQPIPVSVPALSQAQPPPLAAQHKKIVRKPPENQDTSGQK---VKAARP 680

  Fly   326 KHQQFHCPAAEGNQVKKSFS---------CKDCDKTYVSLGALKMHIRTHT--LPCKCNL--CGK 377
            ..|....|..||.....|.|         |..|.:.:.....|..|::.|.  .|.||:.  |.|
  Fly   681 PQQILPSPQQEGQNATHSGSEAPTTSGLICPTCKREFKKKEHLTQHVKLHAGLRPFKCSEEGCDK 745

  Fly   378 AFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHSDIKK---YSCTSCSKTFSRMS 439
            .|||...|..|:.:|:|:|.::|:.|.:.|:.:.||..|.:.|:....   |.|..|:|.|:...
  Fly   746 TFSRKEHLSRHLVSHSGQKMYTCEVCKKPFSRKDNLNKHRRIHTQTSTETLYCCDVCNKNFATKL 810

  Fly   440 LLTKH--------SEGGCPGGSAGSSSSSELNY 464
            ...||        .|...||.:|..:::..|.:
  Fly   811 HYEKHREMHKKIRPESAAPGATASPAAAPALTH 843

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 4/21 (19%)
C2H2 Zn finger 311..331 CDD:275370 3/19 (16%)
zf-C2H2 344..366 CDD:278523 5/30 (17%)
C2H2 Zn finger 346..366 CDD:275368 4/19 (21%)
zf-C2H2 370..392 CDD:278523 9/23 (39%)
C2H2 Zn finger 372..392 CDD:275368 8/21 (38%)
zf-H2C2_2 385..408 CDD:290200 7/22 (32%)
zf-C2H2 398..420 CDD:278523 6/21 (29%)
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
C2H2 Zn finger 428..444 CDD:275368 4/15 (27%)
padNP_650534.2 zf-AD 16..87 CDD:214871
C2H2 Zn finger 710..730 CDD:275368 4/19 (21%)
zf-C2H2 736..760 CDD:278523 9/23 (39%)
C2H2 Zn finger 738..760 CDD:275368 8/21 (38%)
zf-H2C2_2 752..777 CDD:290200 8/24 (33%)
zf-C2H2 766..788 CDD:278523 6/21 (29%)
C2H2 Zn finger 768..788 CDD:275368 6/19 (32%)
zf-H2C2_2 780..808 CDD:290200 9/27 (33%)
C2H2 Zn finger 799..819 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.