DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esg and CG6813

DIOPT Version :9

Sequence 1:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster


Alignment Length:174 Identity:51/174 - (29%)
Similarity:71/174 - (40%) Gaps:25/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 MSPET----MPNA---SAKKDKNQPPR-------YQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQ 339
            :.||.    ||:|   ||....|....       |.||||.:..:..|...:|...|...     
  Fly   108 LCPEVKDLPMPSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGI----- 167

  Fly   340 VKKSFSC--KDCDKTYVSLGALKMHIRTHT--LPCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSC 400
              |:|.|  .:|::::.:...|..|.|.||  .|..|..|.:.||.....|.|.|.|..|:.:.|
  Fly   168 --KNFHCVFLNCERSFATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYEC 230

  Fly   401 QHCHRAFADRSNLRAHLQTHSDIKKYSCTSCSKTFSRMSLLTKH 444
            ..|.::|.....||.|...|.|.:.:.|..|.|.|.|:|.|..|
  Fly   231 DTCKKSFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTH 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 7/21 (33%)
C2H2 Zn finger 311..331 CDD:275370 6/19 (32%)
zf-C2H2 344..366 CDD:278523 6/23 (26%)
C2H2 Zn finger 346..366 CDD:275368 5/21 (24%)
zf-C2H2 370..392 CDD:278523 7/21 (33%)
C2H2 Zn finger 372..392 CDD:275368 7/19 (37%)
zf-H2C2_2 385..408 CDD:290200 7/22 (32%)
zf-C2H2 398..420 CDD:278523 6/21 (29%)
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
C2H2 Zn finger 428..444 CDD:275368 7/15 (47%)
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 6/19 (32%)
C2H2 Zn finger 172..194 CDD:275368 5/21 (24%)
zf-H2C2_2 186..211 CDD:290200 9/24 (38%)
UFD2 <256..>294 CDD:227443 8/19 (42%)
C2H2 Zn finger 258..280 CDD:275368 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468412
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.