DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment esg and CG4820

DIOPT Version :9

Sequence 1:	NP_476600.1	Gene:	esg / 34903	FlyBaseID:	FBgn0001981	Length:	470	Species:	Drosophila melanogaster
Sequence 2:	NP_001097748.1	Gene:	CG4820 / 41344	FlyBaseID:	FBgn0037876	Length:	362	Species:	Drosophila melanogaster

Alignment Length:	89	Identity:	32/89 - (35%)
Similarity:	40/89 - (44%)	Gaps:	1/89 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   369 PCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHSDIKKYSCTSCSK 433
            ||.|..||:.|.....|..|:..|||.|||.|..||:.......||.|...|:: ..|:||.|..
  Fly   221 PCICEHCGRQFKDTSNLHVHLLRHTGTKPFECDQCHQKCYTLHLLRRHQLKHTE-GPYACTFCGL 284

  Fly   434 TFSRMSLLTKHSEGGCPGGSAGSS 457
            .:|..|...:|....|..|.|..|
  Fly   285 EYSTNSSRVRHEREACKKGRAPQS 308

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
esg	NP_476600.1	zf-C2H2	309..331	CDD:278523
		C2H2 Zn finger	311..331	CDD:275370
		zf-C2H2	344..366	CDD:278523
		C2H2 Zn finger	346..366	CDD:275368
		zf-C2H2	370..392	CDD:278523	7/21 (33%)
		C2H2 Zn finger	372..392	CDD:275368	6/19 (32%)
		zf-H2C2_2	385..408	CDD:290200	11/22 (50%)
		zf-C2H2	398..420	CDD:278523	7/21 (33%)
		C2H2 Zn finger	400..420	CDD:275368	6/19 (32%)
		C2H2 Zn finger	428..444	CDD:275368	5/15 (33%)
CG4820	NP_001097748.1	zf-AD	4..75	CDD:285071
		C2H2 Zn finger	224..244	CDD:275368	6/19 (32%)
		C2H2 Zn finger	252..272	CDD:275368	6/19 (32%)
		C2H2 Zn finger	279..297	CDD:275368	6/17 (35%)
		C2H2 Zn finger	322..339	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45457233
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930