DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esg and CG11906

DIOPT Version :9

Sequence 1:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_611402.2 Gene:CG11906 / 37209 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster


Alignment Length:130 Identity:35/130 - (26%)
Similarity:47/130 - (36%) Gaps:15/130 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 QVK-KSFSC--KDCDKTYVSLGALKMHIRTHTLPCK---CNLCGKAFSRPWLLQGHIRTHTGEKP 397
            ||: |||:|  .||.....:|.||..|.........   |:.||..|:....|..|:  |...:.
  Fly   438 QVRLKSFTCFTPDCGYQTDTLVALMKHDYMEHWKMSWFYCHKCGDVFTSKVFLDYHM--HLQNRG 500

  Fly   398 -FSCQHCHRAFADRSNLRAHLQTHSDIKKYSCTSCSKTFSRMSLLTKHSEGGCPGGSAGSSSSSE 461
             :.|..|...|..:..|..|.|.|.....|.|..|...|...:.|..|.:      ..|.|.:.|
  Fly   501 LYICHKCREEFELQHQLDRHFQLHRKGINYHCNFCRLEFLSEAKLLAHCK------KLGHSPNDE 559

  Fly   462  461
              Fly   560  559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esgNP_476600.1 zf-C2H2 309..331 CDD:278523
C2H2 Zn finger 311..331 CDD:275370
zf-C2H2 344..366 CDD:278523 8/23 (35%)
C2H2 Zn finger 346..366 CDD:275368 7/21 (33%)
zf-C2H2 370..392 CDD:278523 6/24 (25%)
C2H2 Zn finger 372..392 CDD:275368 6/19 (32%)
zf-H2C2_2 385..408 CDD:290200 5/23 (22%)
zf-C2H2 398..420 CDD:278523 6/21 (29%)
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
C2H2 Zn finger 428..444 CDD:275368 4/15 (27%)
CG11906NP_611402.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468424
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.