DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esg and CG1663

DIOPT Version :9

Sequence 1:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_610521.1 Gene:CG1663 / 36012 FlyBaseID:FBgn0033449 Length:387 Species:Drosophila melanogaster


Alignment Length:416 Identity:87/416 - (20%)
Similarity:136/416 - (32%) Gaps:103/416 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 HTDDEHIEEEDEDVDVDVDSDPNQTQAAALAAAAAVAAAAAASVVVPTPTYPKYPWNNFHMSP-Y 138
            |....|..|...:.|.|...|..|.:...|.||:....:..|.|   ..::....:....:.| :
  Fly     3 HLVQRHGNESGFNADEDEIQDEVQVEMTNLLAASIAQESKLAEV---QESFKNVEFMEEEVEPNF 64

  Fly   139 TAEFYRTINQQGHQILPLRGDLIAPSSPSDSLGSLSPPPHHYLHGRASSVSPPMRSEIIHRPIGV 203
            :.|     .:|||       |.:|.:|..|   .:|..||...:. ....||.:....|.:   :
  Fly    65 SPE-----KEQGH-------DELASNSHHD---YISNQPHKAFYS-LQRTSPGVIQYFIQQ---L 110

  Fly   204 RQHRFL--------PYPQMPGYPSLGGYTHTHHHHAPISPAYSENS------------------- 241
            |:|:|.        ...:|.....:..... |..|..:.|.....|                   
  Fly   111 RRHKFFWITEHGINKKDRMDSSQKVAEALF-HRFHFQLDPKVVNASARFLQVWFERQYVMQLSSS 174

  Fly   242 ---------YYSMRSMTPESSCSSSLPEDLS---LKHKNLNLNLNTSQPGEQAAAKTGDMSPETM 294
                     |:|:....|.:..|.::.|:..   |..:.|.|:......|               
  Fly   175 DFRCRYPKYYHSLLKFMPTNHISVTICEECDRRFLNERLLRLHKFRVHGG--------------- 224

  Fly   295 PNASAKKDKNQPPRYQCPDCQKSYSTFSGLTKHQ-QFHCPAAEGNQVKKSFSCKDCDKTYVSLGA 358
            ||.:.           |..|.:|:...|.|.:|| ::|....|       :.|..||....|...
  Fly   225 PNPNV-----------CHVCHQSFPLASKLEQHQARYHFKRPE-------WQCSRCDYNAPSKWD 271

  Fly   359 LKMHIRTHTLPCK--CNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHS 421
            .:.|...|.....  |.|||.:......|..|.|||...| ..|.||.|.|.:.|.|::|::...
  Fly   272 FQQHQAMHAGQRNYICELCGHSSKTSSALAVHRRTHDQPK-LCCPHCSRQFRENSTLKSHIRKIH 335

  Fly   422 D---IKKYSCTSCSKTFSRMSLLTKH 444
            |   .::.||..|.:.|..:.||..|
  Fly   336 DGNSARQVSCDFCWRRFKTLELLKLH 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 7/22 (32%)
C2H2 Zn finger 311..331 CDD:275370 7/20 (35%)
zf-C2H2 344..366 CDD:278523 5/21 (24%)
C2H2 Zn finger 346..366 CDD:275368 5/19 (26%)
zf-C2H2 370..392 CDD:278523 7/23 (30%)
C2H2 Zn finger 372..392 CDD:275368 7/19 (37%)
zf-H2C2_2 385..408 CDD:290200 10/22 (45%)
zf-C2H2 398..420 CDD:278523 8/21 (38%)
C2H2 Zn finger 400..420 CDD:275368 8/19 (42%)
C2H2 Zn finger 428..444 CDD:275368 5/15 (33%)
CG1663NP_610521.1 MttA_Hcf106 <33..>91 CDD:294511 16/75 (21%)
C2H2 Zn finger 201..222 CDD:275368 4/20 (20%)
C2H2 Zn finger 259..279 CDD:275368 5/19 (26%)
C2H2 Zn finger 287..307 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..335 CDD:275368 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.