Sequence 1: | NP_476600.1 | Gene: | esg / 34903 | FlyBaseID: | FBgn0001981 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998802.1 | Gene: | scrt2 / 325372 | ZFINID: | ZDB-GENE-030131-4097 | Length: | 312 | Species: | Danio rerio |
Alignment Length: | 297 | Identity: | 110/297 - (37%) |
---|---|---|---|
Similarity: | 145/297 - (48%) | Gaps: | 65/297 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 225 HTHHHHAPISPAYSENSYYSMRSMTPESSCSSSLPEDL-----SLKHKNLNLNLNTS-------- 276
Fly 277 ------QPG-------EQAAAKTGDMSPE--------TMP---------------NASAKKDK-- 303
Fly 304 -------NQPPRYQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTYVSLGALKM 361
Fly 362 HIRTHTLPCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHSDIKKY 426
Fly 427 SCTSCSKTFSRMSLLTKHSEGGCPGGSAGSSSSSELN 463 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
esg | NP_476600.1 | zf-C2H2 | 309..331 | CDD:278523 | 9/21 (43%) |
C2H2 Zn finger | 311..331 | CDD:275370 | 9/19 (47%) | ||
zf-C2H2 | 344..366 | CDD:278523 | 12/21 (57%) | ||
C2H2 Zn finger | 346..366 | CDD:275368 | 12/19 (63%) | ||
zf-C2H2 | 370..392 | CDD:278523 | 16/21 (76%) | ||
C2H2 Zn finger | 372..392 | CDD:275368 | 15/19 (79%) | ||
zf-H2C2_2 | 385..408 | CDD:290200 | 16/22 (73%) | ||
zf-C2H2 | 398..420 | CDD:278523 | 16/21 (76%) | ||
C2H2 Zn finger | 400..420 | CDD:275368 | 15/19 (79%) | ||
C2H2 Zn finger | 428..444 | CDD:275368 | 7/15 (47%) | ||
scrt2 | NP_998802.1 | zf-C2H2 | 162..184 | CDD:278523 | 9/21 (43%) |
C2H2 Zn finger | 164..184 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 195..212 | CDD:275371 | 10/16 (63%) | ||
COG5048 | 219..>295 | CDD:227381 | 53/75 (71%) | ||
zf-C2H2 | 219..241 | CDD:278523 | 16/21 (76%) | ||
C2H2 Zn finger | 221..241 | CDD:275368 | 15/19 (79%) | ||
zf-H2C2_2 | 234..257 | CDD:290200 | 16/22 (73%) | ||
zf-C2H2 | 247..269 | CDD:278523 | 16/21 (76%) | ||
C2H2 Zn finger | 249..269 | CDD:275368 | 15/19 (79%) | ||
C2H2 Zn finger | 277..293 | CDD:275368 | 7/15 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2462 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |