DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esg and snai-1

DIOPT Version :9

Sequence 1:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_499902.2 Gene:snai-1 / 186874 WormBaseID:WBGene00019299 Length:193 Species:Caenorhabditis elegans


Alignment Length:178 Identity:91/178 - (51%)
Similarity:118/178 - (66%) Gaps:14/178 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 MSPETMPNASAKKDK-----NQPPRYQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKD 348
            :||:..|::|:....     ||  :..|..|:|:|.|:.||.:|.|||   .||   |...||..
 Worm    18 ISPDPAPSSSSSSASCSSLDNQ--KLVCQFCKKTYLTYFGLRRHLQFH---KEG---KLQQSCPH 74

  Fly   349 CDKTYVSLGALKMHIRTHTLPCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNL 413
            |.|.|.|.||||||::||:|||.||.|||:|||||||:||:|||||||||.|:.|.|.|||||||
 Worm    75 CKKVYRSPGALKMHLKTHSLPCVCNDCGKSFSRPWLLKGHLRTHTGEKPFGCEFCGRCFADRSNL 139

  Fly   414 RAHLQTHSDIKKYSCTSCSKTFSRMSLLTKHSEGGCPGGSAGSSSSSE 461
            ||||||||..||:.|:.|.::|:|:.:..:| |..|.||.:|..:..|
 Worm   140 RAHLQTHSGEKKHRCSRCGQSFARVQVRQRH-EQCCRGGGSGGEAEKE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 9/21 (43%)
C2H2 Zn finger 311..331 CDD:275370 9/19 (47%)
zf-C2H2 344..366 CDD:278523 12/21 (57%)
C2H2 Zn finger 346..366 CDD:275368 11/19 (58%)
zf-C2H2 370..392 CDD:278523 16/21 (76%)
C2H2 Zn finger 372..392 CDD:275368 15/19 (79%)
zf-H2C2_2 385..408 CDD:290200 15/22 (68%)
zf-C2H2 398..420 CDD:278523 16/21 (76%)
C2H2 Zn finger 400..420 CDD:275368 15/19 (79%)
C2H2 Zn finger 428..444 CDD:275368 4/15 (27%)
snai-1NP_499902.2 C2H2 Zn finger 72..92 CDD:275368 11/19 (58%)
COG5048 98..>155 CDD:227381 43/56 (77%)
C2H2 Zn finger 98..118 CDD:275368 15/19 (79%)
C2H2 Zn finger 126..146 CDD:275368 15/19 (79%)
zf-H2C2_2 138..163 CDD:290200 15/24 (63%)
C2H2 Zn finger 154..170 CDD:275368 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I8191
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1955
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004977
OrthoInspector 1 1.000 - - otm14747
orthoMCL 1 0.900 - - OOG6_107394
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3546
SonicParanoid 1 1.000 - - X955
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.650

Return to query results.
Submit another query.