Sequence 1: | NP_476600.1 | Gene: | esg / 34903 | FlyBaseID: | FBgn0001981 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492338.1 | Gene: | ces-1 / 185718 | WormBaseID: | WBGene00000468 | Length: | 270 | Species: | Caenorhabditis elegans |
Alignment Length: | 229 | Identity: | 88/229 - (38%) |
---|---|---|---|
Similarity: | 125/229 - (54%) | Gaps: | 31/229 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 244 SMRSMTPESSCSSSLPEDL-----SLKHKNL----NLNLNTSQPGEQAAAKTGDMSPETMPNASA 299
Fly 300 -----------------KKDKNQPPRYQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCK 347
Fly 348 DCDKTYVSLGALKMHIRTHTLPCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSN 412
Fly 413 LRAHLQTHSDIKKYSCTSCSKTFSRMSLLTKHSE 446 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
esg | NP_476600.1 | zf-C2H2 | 309..331 | CDD:278523 | 10/21 (48%) |
C2H2 Zn finger | 311..331 | CDD:275370 | 10/19 (53%) | ||
zf-C2H2 | 344..366 | CDD:278523 | 11/21 (52%) | ||
C2H2 Zn finger | 346..366 | CDD:275368 | 11/19 (58%) | ||
zf-C2H2 | 370..392 | CDD:278523 | 15/21 (71%) | ||
C2H2 Zn finger | 372..392 | CDD:275368 | 15/19 (79%) | ||
zf-H2C2_2 | 385..408 | CDD:290200 | 14/22 (64%) | ||
zf-C2H2 | 398..420 | CDD:278523 | 15/21 (71%) | ||
C2H2 Zn finger | 400..420 | CDD:275368 | 13/19 (68%) | ||
C2H2 Zn finger | 428..444 | CDD:275368 | 4/15 (27%) | ||
ces-1 | NP_492338.1 | C2H2 Zn finger | 167..187 | CDD:275368 | 11/19 (58%) |
C2H2 Zn finger | 193..213 | CDD:275368 | 15/19 (79%) | ||
zf-H2C2_2 | 206..229 | CDD:290200 | 14/22 (64%) | ||
zf-C2H2 | 219..241 | CDD:278523 | 15/21 (71%) | ||
C2H2 Zn finger | 221..241 | CDD:275368 | 13/19 (68%) | ||
zf-H2C2_2 | 233..257 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 249..268 | CDD:275368 | 6/19 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2462 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |