DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esg and scrt-1

DIOPT Version :9

Sequence 1:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_491001.2 Gene:scrt-1 / 183848 WormBaseID:WBGene00016948 Length:178 Species:Caenorhabditis elegans


Alignment Length:200 Identity:70/200 - (35%)
Similarity:90/200 - (45%) Gaps:71/200 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 PESSCSSSLPEDLSLKHKNLNLNLNTSQPGEQAAAKTGDMSPETMPNASAKKDKNQPPRYQCPDC 314
            |.||.|.|||          :.:|::..|         .:||.|...                  
 Worm    45 PASSSSPSLP----------SFSLHSDSP---------SLSPSTTVT------------------ 72

  Fly   315 QKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTYVSLGALKMHIRTHTLPCKCNLCGKAF 379
              ||||.|           :.:|.|:|                     ..|.:..|:|.:|||.|
 Worm    73 --SYSTPS-----------SPDGKQLK---------------------FATCSPVCQCKVCGKRF 103

  Fly   380 SRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHSDIKKYSCTSCSKTFSRMSLLTKH 444
            ||.||||||:|||||||||.|:.|.:.|||:||||||:||||..|.:.|..|.|:|:..|.|:||
 Worm   104 SRQWLLQGHLRTHTGEKPFQCEICSKRFADKSNLRAHIQTHSGTKPHKCPRCGKSFALKSYLSKH 168

  Fly   445 SEGGC 449
            .|..|
 Worm   169 EESKC 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 5/21 (24%)
C2H2 Zn finger 311..331 CDD:275370 5/19 (26%)
zf-C2H2 344..366 CDD:278523 0/21 (0%)
C2H2 Zn finger 346..366 CDD:275368 0/19 (0%)
zf-C2H2 370..392 CDD:278523 15/21 (71%)
C2H2 Zn finger 372..392 CDD:275368 14/19 (74%)
zf-H2C2_2 385..408 CDD:290200 15/22 (68%)
zf-C2H2 398..420 CDD:278523 13/21 (62%)
C2H2 Zn finger 400..420 CDD:275368 12/19 (63%)
C2H2 Zn finger 428..444 CDD:275368 6/15 (40%)
scrt-1NP_491001.2 zf-C2H2 94..116 CDD:278523 15/21 (71%)
C2H2 Zn finger 96..116 CDD:275368 14/19 (74%)
zf-H2C2_2 109..132 CDD:290200 15/22 (68%)
C2H2 Zn finger 124..144 CDD:275368 12/19 (63%)
zf-H2C2_2 136..160 CDD:290200 13/23 (57%)
C2H2 Zn finger 152..168 CDD:275368 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.