Sequence 1: | NP_476600.1 | Gene: | esg / 34903 | FlyBaseID: | FBgn0001981 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491001.2 | Gene: | scrt-1 / 183848 | WormBaseID: | WBGene00016948 | Length: | 178 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 70/200 - (35%) |
---|---|---|---|
Similarity: | 90/200 - (45%) | Gaps: | 71/200 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 250 PESSCSSSLPEDLSLKHKNLNLNLNTSQPGEQAAAKTGDMSPETMPNASAKKDKNQPPRYQCPDC 314
Fly 315 QKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTYVSLGALKMHIRTHTLPCKCNLCGKAF 379
Fly 380 SRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHSDIKKYSCTSCSKTFSRMSLLTKH 444
Fly 445 SEGGC 449 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
esg | NP_476600.1 | zf-C2H2 | 309..331 | CDD:278523 | 5/21 (24%) |
C2H2 Zn finger | 311..331 | CDD:275370 | 5/19 (26%) | ||
zf-C2H2 | 344..366 | CDD:278523 | 0/21 (0%) | ||
C2H2 Zn finger | 346..366 | CDD:275368 | 0/19 (0%) | ||
zf-C2H2 | 370..392 | CDD:278523 | 15/21 (71%) | ||
C2H2 Zn finger | 372..392 | CDD:275368 | 14/19 (74%) | ||
zf-H2C2_2 | 385..408 | CDD:290200 | 15/22 (68%) | ||
zf-C2H2 | 398..420 | CDD:278523 | 13/21 (62%) | ||
C2H2 Zn finger | 400..420 | CDD:275368 | 12/19 (63%) | ||
C2H2 Zn finger | 428..444 | CDD:275368 | 6/15 (40%) | ||
scrt-1 | NP_491001.2 | zf-C2H2 | 94..116 | CDD:278523 | 15/21 (71%) |
C2H2 Zn finger | 96..116 | CDD:275368 | 14/19 (74%) | ||
zf-H2C2_2 | 109..132 | CDD:290200 | 15/22 (68%) | ||
C2H2 Zn finger | 124..144 | CDD:275368 | 12/19 (63%) | ||
zf-H2C2_2 | 136..160 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 152..168 | CDD:275368 | 6/15 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2462 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |