DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esg and M03D4.4

DIOPT Version :9

Sequence 1:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:158 Identity:47/158 - (29%)
Similarity:73/158 - (46%) Gaps:13/158 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 MSPETMPNASAKKDKNQPPRYQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTY 353
            |:|.|   .|.|....:..||:|.||.:.::....|..|.:.|    .|.|   ..||..|.|.:
 Worm    71 MNPTT---PSEKSSSGEKGRYECEDCHEMFAVKRELATHMRIH----SGEQ---PHSCTQCGKEF 125

  Fly   354 VSLGALKMHIRTHT--LPCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAH 416
            .:...||.|...||  ....|..|.|||.:...|..|:..|:|.:|..|..||:.|..:.:|..|
 Worm   126 GTRQLLKKHWMWHTGERSHVCPHCNKAFFQKGHLTQHLMIHSGGRPHECPQCHKTFIFKFDLNRH 190

  Fly   417 LQTHSDIKKYSCTSCSKTFSRMSLLTKH 444
            ::.|.: :.:||..|.::|.:..:|.:|
 Worm   191 MKIHQE-RGFSCQQCGRSFLKQVMLDEH 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 6/21 (29%)
C2H2 Zn finger 311..331 CDD:275370 5/19 (26%)
zf-C2H2 344..366 CDD:278523 7/21 (33%)
C2H2 Zn finger 346..366 CDD:275368 6/19 (32%)
zf-C2H2 370..392 CDD:278523 7/21 (33%)
C2H2 Zn finger 372..392 CDD:275368 7/19 (37%)
zf-H2C2_2 385..408 CDD:290200 8/22 (36%)
zf-C2H2 398..420 CDD:278523 6/21 (29%)
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
C2H2 Zn finger 428..444 CDD:275368 4/15 (27%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 5/19 (26%)
zf-H2C2_2 102..127 CDD:290200 9/31 (29%)
C2H2 Zn finger 118..138 CDD:275368 6/19 (32%)
C2H2 Zn finger 146..166 CDD:275368 7/19 (37%)
zf-H2C2_2 158..181 CDD:290200 8/22 (36%)
zf-C2H2 172..194 CDD:278523 6/21 (29%)
C2H2 Zn finger 174..194 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.