DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment esg and ztf-23

DIOPT Version :9

Sequence 1:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_491096.1 Gene:ztf-23 / 171880 WormBaseID:WBGene00021846 Length:419 Species:Caenorhabditis elegans


Alignment Length:215 Identity:59/215 - (27%)
Similarity:91/215 - (42%) Gaps:41/215 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 AYSENSYYSMRSMTPESSCSSSLPEDLSLKHKNLNLNLNTSQPGEQAAAKTGDMSPETMPNASAK 300
            |:.::.|.....::|:....||         .|.:|....::       :...:....:.||:.:
 Worm   173 AHDDSDYILEDDLSPQGPIRSS---------NNYHLKYIRTR-------RMDKLIDNVVVNATQR 221

  Fly   301 KDKNQPPRYQCPDCQKSYSTFSGLTKHQQFHCPAAEG--NQVKKS-FSCKDCDKTYVSLGALKMH 362
            ....|      .||..|...|             |:|  |..|.. |||..|.:|:.....|..|
 Worm   222 DSPEQ------EDCSTSGVAF-------------ADGQTNSGKMGRFSCDRCSRTFKYQSKLDEH 267

  Fly   363 IRTH--TLPCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSCQ-HCHRAFADRSNLRAHLQTHSDIK 424
            .|||  ..|.:|:.|.:.||:...|:.|:|.||||:||.|| .|.:.||..|....|.:|||..:
 Worm   268 RRTHLGVKPFQCHYCTRQFSQRGALKTHMRLHTGERPFVCQWECGKQFASSSAKSHHEKTHSGER 332

  Fly   425 KYSCTSCSKTFSRMSLLTKH 444
            .|.|..|.|:|::.|.:.:|
 Worm   333 PYICNVCGKSFTKNSHVIRH 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 4/21 (19%)
C2H2 Zn finger 311..331 CDD:275370 4/19 (21%)
zf-C2H2 344..366 CDD:278523 8/21 (38%)
C2H2 Zn finger 346..366 CDD:275368 6/19 (32%)
zf-C2H2 370..392 CDD:278523 7/21 (33%)
C2H2 Zn finger 372..392 CDD:275368 7/19 (37%)
zf-H2C2_2 385..408 CDD:290200 12/23 (52%)
zf-C2H2 398..420 CDD:278523 8/22 (36%)
C2H2 Zn finger 400..420 CDD:275368 7/20 (35%)
C2H2 Zn finger 428..444 CDD:275368 5/15 (33%)
ztf-23NP_491096.1 C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
zf-H2C2_2 264..288 CDD:290200 9/23 (39%)
C2H2 Zn finger 279..299 CDD:275368 7/19 (37%)
zf-H2C2_2 291..317 CDD:290200 13/25 (52%)
C2H2 Zn finger 307..328 CDD:275368 7/20 (35%)
zf-H2C2_2 324..344 CDD:290200 8/19 (42%)
C2H2 Zn finger 336..357 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.