DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nht and TAF4B

DIOPT Version :9

Sequence 1:NP_523574.4 Gene:nht / 34902 FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_174093.3 Gene:TAF4B / 839665 AraportID:AT1G27720 Length:720 Species:Arabidopsis thaliana


Alignment Length:269 Identity:54/269 - (20%)
Similarity:96/269 - (35%) Gaps:89/269 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LPDSGSQDASKAKVSIKKNQRASFFDRSSIYKKIMKHLSQGNQADDI--NISEQEWLLDSFLAAL 87
            |.|||.          |||.|.|         |..:.|..|.:...:  .|..|..|.:....:.
plant   481 LLDSGP----------KKNDRVS---------KAYRRLVHGEEERTLLQKIPLQRKLTEIMGKSG 526

  Fly    88 ETYMKHVVKKTIELC-EHRTSYHLHN----------DERC----VMKNDMRVTMMFL-------- 129
            ..::.|.|::.:.|| |.|....|.|          .|:|    .:.:|:|..:..:        
plant   527 LKHIDHDVERCLSLCVEERMRGLLFNIIRISKQRTDAEKCRNRTFITSDIRKEINEMNQKVKEEW 591

  Fly   130 ------------NDLEIADYGSSDDETGFYRKRRAENIDEERKVARLESVNDTALLAISG----- 177
                        ||.|..|..|::        .:|...||:::  |.::.|.....|:.|     
plant   592 EKKHSGEEKNKENDTEKEDQRSNE--------VKANKKDEDKE--RAKAANVAVRAAVGGDDRFS 646

  Fly   178 ----------RKRPGEQLAPESAPSGSKVAKLTGAP-IQRACAPRFKHMNIRDVLQFMEEDRRYA 231
                      |..||.....:....|::..|..|.| :.|:       ::::||:..:|::.:.:
plant   647 KWKLMAEARQRSSPGPGRNSKKLSGGTQFGKNQGLPKVVRS-------ISVKDVIAVVEKEPQMS 704

  Fly   232 RSNMLFEAY 240
            ||.:|:..|
plant   705 RSTLLYRVY 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 53/265 (20%)
TAF4BNP_174093.3 RST 89..144 CDD:288985
TAF4 463..711 CDD:283017 53/265 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001841
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15138
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.