powered by:
Protein Alignment nht and TAF4
DIOPT Version :9
Sequence 1: | NP_523574.4 |
Gene: | nht / 34902 |
FlyBaseID: | FBgn0041103 |
Length: | 245 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001190458.1 |
Gene: | TAF4 / 834330 |
AraportID: | AT5G43130 |
Length: | 852 |
Species: | Arabidopsis thaliana |
Alignment Length: | 46 |
Identity: | 10/46 - (21%) |
Similarity: | 28/46 - (60%) |
Gaps: | 5/46 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 193 GSKVAKLTGAPIQRACAPR-FKHMNIRDVLQFMEEDRRYARSNMLF 237
|.:|.|..|:.:| |: .:.::::||:..:|.:.:.::|.:::
plant 807 GRRVGKNQGSSLQ----PKVVRTISVKDVVAVLEREPQMSKSTLMY 848
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2341 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001841 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR15138 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.000 |
|
Return to query results.
Submit another query.