DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nht and TAF4

DIOPT Version :9

Sequence 1:NP_523574.4 Gene:nht / 34902 FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001190458.1 Gene:TAF4 / 834330 AraportID:AT5G43130 Length:852 Species:Arabidopsis thaliana


Alignment Length:46 Identity:10/46 - (21%)
Similarity:28/46 - (60%) Gaps:5/46 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 GSKVAKLTGAPIQRACAPR-FKHMNIRDVLQFMEEDRRYARSNMLF 237
            |.:|.|..|:.:|    |: .:.::::||:..:|.:.:.::|.:::
plant   807 GRRVGKNQGSSLQ----PKVVRTISVKDVVAVLEREPQMSKSTLMY 848

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 10/46 (22%)
TAF4NP_001190458.1 Med15 <82..529 CDD:255446
RST 187..250 CDD:288985
TAF4 537..850 CDD:283017 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001841
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15138
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.