DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nht and si:dkey-219c3.2

DIOPT Version :9

Sequence 1:NP_523574.4 Gene:nht / 34902 FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_005163125.1 Gene:si:dkey-219c3.2 / 564106 ZFINID:ZDB-GENE-090313-238 Length:976 Species:Danio rerio


Alignment Length:292 Identity:66/292 - (22%)
Similarity:121/292 - (41%) Gaps:69/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPIQPYAGQLLIINDLILPDSGS-QD-------ASKAKVSI-KKNQR------------------ 45
            |.|...|.|...:||   |..|: :|       ||.|.|:: ::|.|                  
Zfish   697 VAIHASANQKQKLND---PGGGTFRDDDDINDVASMAGVNLNEENARILATGSELVGTQIRSCKD 758

  Fly    46 ASFFDRSSIYKKIMKHLSQGNQADDINISEQEWLLDSFLA-ALETYMKHVVKKTIELCEHRTSYH 109
            .:|...|.::|::::      .|....::|......:.:: |.::.::.:::|...:.:||.. .
Zfish   759 EAFLPASLLHKRLLE------TAKKFGVTEVSMETVTLISHATQSRLRSMLEKVSAVAQHRAD-S 816

  Fly   110 LHNDERCVMKNDMRVTMMFLNDLEIADYGSSDDETG--FYRKRRAENIDEERKVARLE------- 165
            ..:::.....:|:|..:.|...||..:....|||..  ..:..::.:..|:.:.|||:       
Zfish   817 CKDEDLYEQTSDVRTQLKFFEQLEKIEKQRKDDEERELLMKAAKSRSRQEDPEQARLKQKAKEMQ 881

  Fly   166 ----------SVNDTALLAISGRKR-----PGEQLAPESAPSGSKVAKLTGAPIQ-----RACAP 210
                      ..|.|||.||..||:     ||.....| .|:||. ...||:...     |....
Zfish   882 QQELAQMRQRDANLTALAAIGPRKKRKLDSPGASAGAE-LPAGSS-GSATGSTSSSSSSVRQTRQ 944

  Fly   211 RFKHMNIRDVLQFMEEDRRYARSNMLFEAYLK 242
            |...:|:||::..:|::|..|||.:|::|.||
Zfish   945 RITRVNLRDLIFCLEQERTTARSTLLYKALLK 976

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 62/284 (22%)
si:dkey-219c3.2XP_005163125.1 TAFH 531..616 CDD:284862
TAF4 723..973 CDD:283017 54/258 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001841
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15138
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.