DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nht and Taf4

DIOPT Version :9

Sequence 1:NP_523574.4 Gene:nht / 34902 FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001074561.1 Gene:Taf4 / 228980 MGIID:2152346 Length:1042 Species:Mus musculus


Alignment Length:324 Identity:71/324 - (21%)
Similarity:117/324 - (36%) Gaps:98/324 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISLEVPIQPYAGQLL---IINDLILPDS------GSQDASKAKVSIKKNQRASFFDRSSIYKKIM 59
            |.|..|.|....||.   ::...:||.:      .:|.|:..|..:|:....||.|...|     
Mouse   732 IMLTTPQQIQLNQLQPVPVVKPTVLPGTKALSTVSAQAAAAQKNKLKEPGGGSFRDDDDI----- 791

  Fly    60 KHLSQGNQADDINISEQEWLL-----------------DSFL-------AALETYMKHVVKK--- 97
               :.......:|:||:...:                 |:||       ..||...||.:.:   
Mouse   792 ---NDVASMAGVNLSEESARILATNSELVGTLTRSCKDDTFLLPAPLQRRILEIGKKHGITELHP 853

  Fly    98 -TIELCEHRTSYHLHN------------------DERCVMKNDMRVTMMFLNDLEIADYGSSDDE 143
             .:....|.|...|.|                  |:|....:|:|..:.|...|:..:....|::
Mouse   854 DVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQ 918

  Fly   144 TG--FYRKRRAENIDEERKVARLE-----------------SVNDTALLAISGRKR-------PG 182
            ..  ..|..::.:..|:.:..||:                 ..|.|||.||..||:       ||
Mouse   919 EREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCTGPG 983

  Fly   183 ---EQLAPESA-PSGSKVAKLTGAPIQRACAPRFKHMNIRDVLQFMEEDRRYARSNMLFEAYLK 242
               |...|.:| |.||.|    |.| ::....|...:|:||::..:|.:|..:.|.:|::|:||
Mouse   984 SGAEGSGPGAAVPGGSGV----GTP-RQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK 1042

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 10..238 CDD:173965 65/312 (21%)
Taf4NP_001074561.1 TAFH 550..633 CDD:284862
TAF4 791..1039 CDD:283017 53/260 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2341
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001841
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15138
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.