DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nht and taf-4

DIOPT Version :10

Sequence 1:NP_523574.4 Gene:nht / 34902 FlyBaseID:FBgn0041103 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_490728.2 Gene:taf-4 / 171630 WormBaseID:WBGene00006385 Length:523 Species:Caenorhabditis elegans


Alignment Length:212 Identity:42/212 - (19%)
Similarity:78/212 - (36%) Gaps:59/212 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RASFFDRSSIYKKIMKHLSQGNQADDINISEQEWLLDSFLAALETYMKHVVKKTIELCEHRTSYH 109
            ::|......:..:|.|.:..       :.|.:|..|.:...|:|::::.::.....:.|||.. .
 Worm   325 KSSILKPDEVLNRITKRMMS-------SCSVEEEALVAISDAVESHLRELITLMAGVAEHRVE-S 381

  Fly   110 LHNDERCVMKNDMRVTMMFLNDLEIADYGSSDDETGFYRKRRAENIDEERKVARLESVNDTALLA 174
            |...|..|..:|::..:.||.||:                |:.|.:.|.|:        ..:|:.
 Worm   382 LRIPENYVAIDDVKRQLRFLEDLD----------------RQEEELRESRE--------KESLIR 422

  Fly   175 ISGRKRPGEQ----------------------LAPESAPSGSKVAK----LTGAPIQRACAPRFK 213
            :|..|..|::                      .|..:|.|.:|..|    .||| ...|..||..
 Worm   423 MSKNKNSGKETIEKAKEMQRQDAEAKRNRDANAAAIAALSSNKTVKNKWENTGA-ATTAPRPRTV 486

  Fly   214 HMNIRDVLQFMEEDRRY 230
            .:..||:...:.:|.|:
 Worm   487 RVTTRDLHLLVNQDSRF 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nhtNP_523574.4 TAF4 <85..237 CDD:461598 36/172 (21%)
taf-4NP_490728.2 TAFH 103..196 CDD:197785
HFD_TAF4 325..422 CDD:467027 24/128 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.