DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15262 and Cnot2

DIOPT Version :9

Sequence 1:NP_609750.1 Gene:CG15262 / 34901 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001032936.2 Gene:Cnot2 / 72068 MGIID:1919318 Length:550 Species:Mus musculus


Alignment Length:449 Identity:99/449 - (22%)
Similarity:164/449 - (36%) Gaps:174/449 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DQQEVESSPSPPPPPPFQSPLSSPESLQTPDGYPILYVDVVKNKPKQELPPSASPSQPLAPEFSI 75
            |:...|.|.:|       :||.:|.:.:.|      ||.:|           ..|:...:.:|||
Mouse   245 DRNRREGSGNP-------TPLINPLAGRAP------YVGMV-----------TKPANEQSQDFSI 285

  Fly    76 FREDFPALPGS-----------LPSALPTALPTTSS---PVVPDDWTAMMSNSEQVELAKFRNTV 126
            ..|||||||||           ..|.|.|:..||||   |..|.|.::...|:.|          
Mouse   286 HNEDFPALPGSSYKDPTSSNDDSKSNLSTSGKTTSSTDGPKFPGDKSSTTQNNNQ---------- 340

  Fly   127 IRNSSDPCVNANGNEVLRQPTHAPEKRQNMELLPHMYGYLGNPFRLNLSMIFTKQFLLEGVRQRA 191
                                     :::.:::||                        :|     
Mouse   341 -------------------------QKKGIQVLP------------------------DG----- 351

  Fly   192 INAAHKRAALAKPAIQPPPGFENCKIFARLITNSDGMPLGGVTFELGSPTNETTSNVEAKPSGST 256
                                         .:||   :|.|.||.:                    
Mouse   352 -----------------------------RVTN---IPQGMVTDQ-------------------- 364

  Fly   257 IQGAFGMLGLAKKLRSINQNP----LLFGNNVAHNIG---GAADSI---FTGPIQEARLTPQEMS 311
                |||:||...:|:...:|    |..|:::. .:|   .:.:::   |..|...:...||::.
Mouse   365 ----FGMIGLLTFIRAAETDPGMVHLALGSDLT-TLGLNLNSPENLYPKFASPWASSPCRPQDID 424

  Fly   312 YKLPLNYLFNVNM--SLQEPKIEEMHDELLFFFFYTYAGDMMQMLAAAELAERGWRYHKYEHFWV 374
            :.:|..||.|:::  .|...|:....::|||:.:|...||::|:|||.||..|.|||||.|..|:
Mouse   425 FHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWI 489

  Fly   375 IRQADNPNYLYHGFREFGEYNYFNMWQWKILPRHFYLDPEILERTLSKEELYVTYGYHP 433
            .|.......:.....|.|.|.:|:...|:.:.:.|:|:.:.||   .:..|..|:.|:|
Mouse   490 TRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLE---ERPHLPSTFNYNP 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 38/124 (31%)
Cnot2NP_001032936.2 NOT2_3_5 406..529 CDD:398019 38/122 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841566
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5601
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2523
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003536
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23326
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2209
SonicParanoid 1 1.000 - - X2412
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.