DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15262 and not2

DIOPT Version :9

Sequence 1:NP_609750.1 Gene:CG15262 / 34901 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_587823.2 Gene:not2 / 2538778 PomBaseID:SPCC4G3.15c Length:306 Species:Schizosaccharomyces pombe


Alignment Length:141 Identity:46/141 - (32%)
Similarity:61/141 - (43%) Gaps:29/141 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 PIQEARL-------------TPQEMS---YKLPLNYLFNVNMSLQEPKIEEMHDELLFFFFYTYA 347
            |::|.||             |.:.:|   :|||..|. |||......||.:..||.||:.|||..
pombe   164 PVEEDRLISTNLFSPWAELNTKKPVSQPMFKLPACYK-NVNPPPAISKIFQFSDETLFYIFYTMP 227

  Fly   348 GDMMQMLAAAELAERGWRYHKYEHFWVIRQAD------NPNYLYHGFREFGEYNYFNMWQWKILP 406
            .|:||..||.||..|.||:||....|:.....      .|.:      |.|.|.:|:...||.:.
pombe   228 RDVMQEAAAQELTNRNWRFHKELRVWLTPVPGMKPLQRTPQF------ERGYYMFFDPIHWKRIK 286

  Fly   407 RHFYLDPEILE 417
            :.|.|....||
pombe   287 KDFLLMYAALE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 44/136 (32%)
not2NP_587823.2 CDC36 131..297 CDD:227888 44/139 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 74 1.000 Domainoid score I2512
eggNOG 1 0.900 - - E1_COG5601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003536
OrthoInspector 1 1.000 - - otm47013
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23326
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2209
SonicParanoid 1 1.000 - - X2412
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.