DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15262 and cnot2

DIOPT Version :9

Sequence 1:NP_609750.1 Gene:CG15262 / 34901 FlyBaseID:FBgn0028852 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_005163166.1 Gene:cnot2 / 100037372 ZFINID:ZDB-GENE-070410-70 Length:530 Species:Danio rerio


Alignment Length:440 Identity:96/440 - (21%)
Similarity:160/440 - (36%) Gaps:156/440 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DQQEVESSPSPPPPPPFQSPLSSPESLQTPDGYPILYVDVVKNKPKQELPPSASPSQPLAPEFSI 75
            |:...|.:.:|       :||.:|.:.:.|      ||.:|           ..||...:.:|||
Zfish   225 DRSRREGNGNP-------TPLHNPLAGRAP------YVGMV-----------TKPSNEQSQDFSI 265

  Fly    76 FREDFPALPGSLPSALPTALPTTSSPVVPDDWTAMMSN-----SEQVELAKFRNTVIRNSSDPCV 135
            ..||||||||          |....|.:..|.:....|     |...:..||       ..|...
Zfish   266 HNEDFPALPG----------PNYKDPTLSTDESKSSLNSSGKGSSSADGPKF-------PGDKTS 313

  Fly   136 NANGNEVLRQPTHAPEKRQNMELLPHMYGYLGNPFRLNLSMIFTKQFLLEGVRQRAINAAHKRAA 200
            :|..|.         ::::.:::||                                        
Zfish   314 SAQNNN---------QQKKGIQVLP---------------------------------------- 329

  Fly   201 LAKPAIQPPPGFENCKIFARLITNSDGMPLGGVTFELGSPTNETTSNVEAKPSGSTIQGAFGMLG 265
                                     ||                ..:|:   ||| .:...|||:|
Zfish   330 -------------------------DG----------------KVTNI---PSG-MVTDQFGMIG 349

  Fly   266 LAKKLRSINQNP----LLFGNNVAHNIG---GAADSI---FTGPIQEARLTPQEMSYKLPLNYLF 320
            |...:|:...:|    |..|:::. .:|   .:.:::   |..|...|...||::.:.:|..||.
Zfish   350 LLTFIRAAETDPGMVHLALGSDLT-TLGLNLNSPENLYPKFASPWASAPCRPQDIDFHVPSEYLT 413

  Fly   321 NVNM--SLQEPKIEEMHDELLFFFFYTYAGDMMQMLAAAELAERGWRYHKYEHFWVIRQADNPNY 383
            |:::  .|...|:....::|||:.:|...||::|:|||.||..|.|||||.|..|:.|.......
Zfish   414 NIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDLLQLLAAVELFNRDWRYHKEERVWITRAPGMEPT 478

  Fly   384 LYHGFREFGEYNYFNMWQWKILPRHFYLDPEILERTLSKEELYVTYGYHP 433
            |.....|.|.|.:|:...|:.:.:.|:|:.:.||   .:..:..|:.|:|
Zfish   479 LKTNTYERGTYYFFDCHNWRKVAKEFHLEYDKLE---ERPHVPTTFNYNP 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15262NP_609750.1 NOT2_3_5 294..414 CDD:282064 40/124 (32%)
cnot2XP_005163166.1 NOT2_3_5 386..509 CDD:282064 40/122 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585909
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5601
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1273874at2759
OrthoFinder 1 1.000 - - FOG0003536
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23326
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2209
SonicParanoid 1 1.000 - - X2412
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.