DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UK114 and HMF1

DIOPT Version :9

Sequence 1:NP_001260465.1 Gene:UK114 / 34897 FlyBaseID:FBgn0086691 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_010978.3 Gene:HMF1 / 856785 SGDID:S000000859 Length:129 Species:Saccharomyces cerevisiae


Alignment Length:127 Identity:46/127 - (36%)
Similarity:79/127 - (62%) Gaps:3/127 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTIVRKLISTANAAKPVAPYNQAVVADRTVYVSGCLGLDKDTMKLVPGGPTEQAQKALENLEAV 65
            ::|:...:..:|.||  .|.|:.|:..:..:::||.:.:..|. |||.|...::|::.::|::.|
Yeast     2 VTTLTPVICESAPAA--AASYSHAMKVNNLIFLSGQIPVTPDN-KLVEGSIADKAEQVIQNIKNV 63

  Fly    66 LKAADSGVDKVIKNTVFLKDLNDFGAVNEVYKRVFNKDFPARSCFQVAKLPMDALVEIECIA 127
            |:|::|.:|:|:|..:||.|:|.|...|.||.:.||...|||||..||.||:...:|:|.||
Yeast    64 LEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIA 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UK114NP_001260465.1 YjgF_YER057c_UK114_family 6..127 CDD:299145 43/120 (36%)
HMF1NP_010978.3 TIGR00004 24..127 CDD:129116 39/103 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344168
Domainoid 1 1.000 86 1.000 Domainoid score I1868
eggNOG 1 0.900 - - E1_COG0251
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4261
Inparanoid 1 1.050 87 1.000 Inparanoid score I1573
Isobase 1 0.950 - 0 Normalized mean entropy S674
OMA 1 1.010 - - QHG60620
OrthoFinder 1 1.000 - - FOG0001697
OrthoInspector 1 1.000 - - otm46618
orthoMCL 1 0.900 - - OOG6_100612
Panther 1 1.100 - - LDO PTHR11803
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R724
SonicParanoid 1 1.000 - - X1603
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.