DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UK114 and DPH6

DIOPT Version :9

Sequence 1:NP_001260465.1 Gene:UK114 / 34897 FlyBaseID:FBgn0086691 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_013244.1 Gene:DPH6 / 850835 SGDID:S000004133 Length:685 Species:Saccharomyces cerevisiae


Alignment Length:101 Identity:18/101 - (17%)
Similarity:47/101 - (46%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VYVSGCLGLDKDTMKLVPGGPTEQAQKALENLEAVLKAADSGVDKVIKNTVFLKDLNDFGAVNEV 95
            :|:|.......:|::       :|::.....|..:|.:.....:.::..::.::|:::||.:|::
Yeast   322 LYISNLQSRKSETVE-------KQSEDIFTELADILHSNQIPRNHILSASLLIRDMSNFGKINKI 379

  Fly    96 YKRVFNKDF-----PARSCFQVAKLPMDALVEIECI 126
            |....:...     |:|:|.....||.|..|::..:
Yeast   380 YNEFLDLSKYGPLPPSRACVGSKCLPEDCHVQLSVV 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UK114NP_001260465.1 YjgF_YER057c_UK114_family 6..127 CDD:299145 18/101 (18%)
DPH6NP_013244.1 MJ0570_dom 1..264 CDD:273000
eu_AANH_C_1 313..417 CDD:100012 18/101 (18%)
eu_AANH_C_2 449..571 CDD:100013
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0251
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.