DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UK114 and AT3G20390

DIOPT Version :9

Sequence 1:NP_001260465.1 Gene:UK114 / 34897 FlyBaseID:FBgn0086691 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001327365.1 Gene:AT3G20390 / 821584 AraportID:AT3G20390 Length:255 Species:Arabidopsis thaliana


Alignment Length:126 Identity:53/126 - (42%)
Similarity:82/126 - (65%) Gaps:0/126 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STIVRKLISTANAAKPVAPYNQAVVADRTVYVSGCLGLDKDTMKLVPGGPTEQAQKALENLEAVL 66
            |::.::::||..|...:.||:||:.|:..|::||.|||..:|.|.|.....:|.::.|:|:..:|
plant   128 SSVKKEVVSTEKAPAALGPYSQAIKANNLVFLSGVLGLIPETGKFVSESVEDQTEQVLKNMGEIL 192

  Fly    67 KAADSGVDKVIKNTVFLKDLNDFGAVNEVYKRVFNKDFPARSCFQVAKLPMDALVEIECIA 127
            ||:.:....|:|.|:.|.||.||..|||:|.:.|....||||.:|||.||::|.:||||||
plant   193 KASGADYSSVVKTTIMLADLADFKTVNEIYAKYFPAPSPARSTYQVAALPLNAKIEIECIA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UK114NP_001260465.1 YjgF_YER057c_UK114_family 6..127 CDD:299145 50/120 (42%)
AT3G20390NP_001327365.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I2339
eggNOG 1 0.900 - - E1_COG0251
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4261
Inparanoid 1 1.050 109 1.000 Inparanoid score I2083
OMA 1 1.010 - - QHG60620
OrthoDB 1 1.010 - - D1435276at2759
OrthoFinder 1 1.000 - - FOG0001697
OrthoInspector 1 1.000 - - oto3644
orthoMCL 1 0.900 - - OOG6_100612
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1603
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.