DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UK114 and AT3G04480

DIOPT Version :10

Sequence 1:NP_609747.1 Gene:UK114 / 34897 FlyBaseID:FBgn0086691 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_187098.2 Gene:AT3G04480 / 819604 AraportID:AT3G04480 Length:718 Species:Arabidopsis thaliana


Alignment Length:123 Identity:34/123 - (27%)
Similarity:54/123 - (43%) Gaps:14/123 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VAPYNQAVVADRTVYVSGCLGLDKDTMKLVPGGPTEQAQKALENLEAVLKAADSGV-DKVIKNTV 81
            :.||:||.:....::::|.||||..||.|...|...:..:||.|.||:.::.:..: ...|...|
plant   428 IGPYSQATLHQSVLHMAGQLGLDPPTMNLQTEGAIAELNQALTNSEAIAESFNCSISSSAILFVV 492

  Fly    82 FLKDLNDFGAVNEVY-------------KRVFNKDFPARSCFQVAKLPMDALVEIECI 126
            |..........|:::             :||.|...|......|..||..||||::.|
plant   493 FCSARTKQSERNQLHEKFVTFLGLAKSSRRVQNVLDPMFLYILVPDLPKRALVEVKPI 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UK114NP_609747.1 YjgF_YER057c_UK114_family 6..127 CDD:447879 34/123 (28%)
AT3G04480NP_187098.2 AANH_PF0828-like 2..217 CDD:467498
eu_AANH_C_1 297..392 CDD:100012
eu_AANH_C_2 431..551 CDD:100013 33/120 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.