DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UK114 and Rida

DIOPT Version :9

Sequence 1:NP_001260465.1 Gene:UK114 / 34897 FlyBaseID:FBgn0086691 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_113902.2 Gene:Rida / 65151 RGDID:70940 Length:137 Species:Rattus norvegicus


Alignment Length:134 Identity:68/134 - (50%)
Similarity:94/134 - (70%) Gaps:0/134 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTIVRKLISTANAAKPVAPYNQAVVADRTVYVSGCLGLDKDTMKLVPGGPTEQAQKALENLEAV 65
            ||:|:||:|||:.|...:..|:|||:.|||:||||.:|:|..:.:|||||..|:|::||:||..:
  Rat     1 MSSIIRKVISTSKAPAAIGAYSQAVLVDRTIYVSGQIGMDPSSGQLVPGGVAEEAKQALKNLGEI 65

  Fly    66 LKAADSGVDKVIKNTVFLKDLNDFGAVNEVYKRVFNKDFPARSCFQVAKLPMDALVEIECIALTG 130
            ||||......|:|.||.|.|:||||.|||:||..|..:.|||:.:|||.||..:.:|||.||:.|
  Rat    66 LKAAGCDFTNVVKTTVLLADINDFGTVNEIYKTYFQGNLPARAAYQVAALPKGSRIEIEAIAVQG 130

  Fly   131 SVET 134
            ...|
  Rat   131 PFTT 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UK114NP_001260465.1 YjgF_YER057c_UK114_family 6..127 CDD:299145 61/120 (51%)
RidaNP_113902.2 TIGR00004 6..129 CDD:129116 63/122 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341984
Domainoid 1 1.000 121 1.000 Domainoid score I5577
eggNOG 1 0.900 - - E1_COG0251
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4261
Inparanoid 1 1.050 139 1.000 Inparanoid score I4426
OMA 1 1.010 - - QHG60620
OrthoDB 1 1.010 - - D1435276at2759
OrthoFinder 1 1.000 - - FOG0001697
OrthoInspector 1 1.000 - - oto96089
orthoMCL 1 0.900 - - OOG6_100612
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1603
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.670

Return to query results.
Submit another query.