DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UK114 and rida

DIOPT Version :9

Sequence 1:NP_001260465.1 Gene:UK114 / 34897 FlyBaseID:FBgn0086691 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001012315.1 Gene:rida / 436849 ZFINID:ZDB-GENE-040718-315 Length:135 Species:Danio rerio


Alignment Length:132 Identity:62/132 - (46%)
Similarity:89/132 - (67%) Gaps:1/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTIVRKLISTANAAKPVAPYNQAVVADRTVYVSGCLGLDKDTMKLVPGGPTEQAQKALENLEAV 65
            ||.|:||:|.||.|...:.||:|||:.|||:|:||.||:|..:.:|. .|...|.::||.|:..:
Zfish     1 MSAIIRKIIHTAAAPAAIGPYSQAVLVDRTMYISGQLGMDPASGQLA-AGVQAQTKQALINIGEI 64

  Fly    66 LKAADSGVDKVIKNTVFLKDLNDFGAVNEVYKRVFNKDFPARSCFQVAKLPMDALVEIECIALTG 130
            ||||..|.:.|:|.||.:.|:|:|..||:|||:.|..:||||:.:||..||...|||||.:|:.|
Zfish    65 LKAAGCGYENVVKATVLMTDINEFNTVNDVYKQFFKSNFPARAAYQVVALPRGGLVEIEAVAVLG 129

  Fly   131 SV 132
            .:
Zfish   130 PI 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UK114NP_001260465.1 YjgF_YER057c_UK114_family 6..127 CDD:299145 57/120 (48%)
ridaNP_001012315.1 TIGR00004 6..128 CDD:129116 58/122 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582041
Domainoid 1 1.000 108 1.000 Domainoid score I6415
eggNOG 1 0.900 - - E1_COG0251
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4261
Inparanoid 1 1.050 125 1.000 Inparanoid score I4684
OMA 1 1.010 - - QHG60620
OrthoDB 1 1.010 - - D1435276at2759
OrthoFinder 1 1.000 - - FOG0001697
OrthoInspector 1 1.000 - - oto40473
orthoMCL 1 0.900 - - OOG6_100612
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R724
SonicParanoid 1 1.000 - - X1603
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.700

Return to query results.
Submit another query.