DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UK114 and CG1578

DIOPT Version :9

Sequence 1:NP_001260465.1 Gene:UK114 / 34897 FlyBaseID:FBgn0086691 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001285140.1 Gene:CG1578 / 32135 FlyBaseID:FBgn0030336 Length:901 Species:Drosophila melanogaster


Alignment Length:136 Identity:32/136 - (23%)
Similarity:61/136 - (44%) Gaps:23/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RKLISTANAAKPVAPYNQAVVADRTVYVSGCLGLDKDTMKLVPGGPTEQAQKALENLEAVLKAAD 70
            |:....||.|:      .|:.|...::::|..|...:       |..:..|:||:.|..:.:|..
  Fly   452 REFRPLANEAR------AAINAKGWMWLAGIQGSGTE-------GIEQGMQQALDTLRDLCQAKG 503

  Fly    71 SGVDKVIKNTVFLKDLNDFGAVNEVYKRVFNKDF---PARSCFQVAKLPMDALVEIECIA----L 128
            ..:..:...|::::.:.::..:|.||.|.|  ||   |.|.|.: ..||....|.:|.||    :
  Fly   504 YDLQDLCYVTLYVRSIGEYPLLNRVYHRAF--DFHNPPTRVCVE-CPLPDGCHVVMEAIAYRQPV 565

  Fly   129 TGSVET 134
            .|::.:
  Fly   566 AGTISS 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UK114NP_001260465.1 YjgF_YER057c_UK114_family 6..127 CDD:299145 29/123 (24%)
CG1578NP_001285140.1 Alpha_ANH_like_IV 2..211 CDD:238952
eu_AANH_C_1 465..561 CDD:100012 25/105 (24%)
eu_AANH_C_2 610..716 CDD:100013
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0251
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.