DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UK114 and mmf2

DIOPT Version :9

Sequence 1:NP_001260465.1 Gene:UK114 / 34897 FlyBaseID:FBgn0086691 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001342937.1 Gene:mmf2 / 2543017 PomBaseID:SPAC1039.10 Length:126 Species:Schizosaccharomyces pombe


Alignment Length:111 Identity:46/111 - (41%)
Similarity:67/111 - (60%) Gaps:5/111 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PYNQAVVADRTVYVSGCLGLDKDTMKLVPGGPTEQAQKALENLEAVLKAADSGVDKVIKNTVFLK 84
            ||||||.:...::.||...: ||. ..|||...||.:..:|||..||:.|.|.::|::|..:||.
pombe    16 PYNQAVKSGGLIFCSGQAAV-KDG-NFVPGTIQEQTRLTIENLAEVLRVAGSSLEKLVKVNIFLT 78

  Fly    85 DLNDFGAVNEVYKRVFNKDFPARSCFQVAKLPMDA---LVEIECIA 127
            |::||.|:|||||.:.....|||:.....|:|:.:   .:||||||
pombe    79 DIDDFAAMNEVYKEMLPDPMPARTTVAAGKIPLSSKGGKIEIECIA 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UK114NP_001260465.1 YjgF_YER057c_UK114_family 6..127 CDD:299145 44/109 (40%)
mmf2NP_001342937.1 YjgF_YER057c_UK114_family 17..124 CDD:100004 43/108 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2222
eggNOG 1 0.900 - - E1_COG0251
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1806
OMA 1 1.010 - - QHG60620
OrthoFinder 1 1.000 - - FOG0001697
OrthoInspector 1 1.000 - - otm47085
orthoMCL 1 0.900 - - OOG6_100612
Panther 1 1.100 - - O PTHR11803
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R724
SonicParanoid 1 1.000 - - X1603
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.