DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UK114 and mmf1

DIOPT Version :9

Sequence 1:NP_001260465.1 Gene:UK114 / 34897 FlyBaseID:FBgn0086691 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_596433.1 Gene:mmf1 / 2540461 PomBaseID:SPBC2G2.04c Length:162 Species:Schizosaccharomyces pombe


Alignment Length:112 Identity:46/112 - (41%)
Similarity:68/112 - (60%) Gaps:5/112 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PYNQAVVADRTVYVSGCLGLDKDTMKLVPGGPTEQAQKALENLEAVLKAADSGVDKVIKNTVFLK 84
            |||||:.|:..:|.||.:.:...  |::.|...:|.::.|.||:.||..|.|.::|::|..:||.
pombe    52 PYNQAIKANGVIYCSGQIPVANG--KVIEGTVGDQTRQCLLNLQEVLTEAGSSLNKIVKVNIFLA 114

  Fly    85 DLNDFGAVNEVYKRVFNKDFPARSCFQVAKLPMD---ALVEIECIAL 128
            |::||.|||:||..|.....|||||..|..:|:.   ..:|||||||
pombe   115 DMDDFAAVNKVYTEVLPDPKPARSCVAVKTVPLSTQGVKIEIECIAL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UK114NP_001260465.1 YjgF_YER057c_UK114_family 6..127 CDD:299145 43/109 (39%)
mmf1NP_596433.1 YjgF_YER057c_UK114_family 39..162 CDD:299145 46/112 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2222
eggNOG 1 0.900 - - E1_COG0251
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1806
OMA 1 1.010 - - QHG60620
OrthoFinder 1 1.000 - - FOG0001697
OrthoInspector 1 1.000 - - otm47085
orthoMCL 1 0.900 - - OOG6_100612
Panther 1 1.100 - - LDO PTHR11803
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R724
SonicParanoid 1 1.000 - - X1603
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.