DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UK114 and C23G10.2

DIOPT Version :9

Sequence 1:NP_001260465.1 Gene:UK114 / 34897 FlyBaseID:FBgn0086691 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_741177.2 Gene:C23G10.2 / 182812 WormBaseID:WBGene00016011 Length:171 Species:Caenorhabditis elegans


Alignment Length:130 Identity:63/130 - (48%)
Similarity:86/130 - (66%) Gaps:1/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVRKLISTANAAKPVAPYNQAVVADRTVYVSGCLGLDKDTMKLVPGGPTEQAQKALENLEAVLKA 68
            :.|::||:|||...:.||:|||.|..|:|:||.||||..|..| ..|..||..::|:||..||||
 Worm    39 VTRQIISSANAPGAIGPYSQAVRAGNTIYLSGSLGLDPKTGDL-KEGVVEQTHQSLKNLGEVLKA 102

  Fly    69 ADSGVDKVIKNTVFLKDLNDFGAVNEVYKRVFNKDFPARSCFQVAKLPMDALVEIECIALTGSVE 133
            |.:....|:|.||.|:::.||.||||||.:.|...:|||:.:|||.||...|||||.:|:.|.:|
 Worm   103 AGADYGNVVKTTVLLQNIADFAAVNEVYGQYFKSPYPARAAYQVAALPKGGLVEIEAVAIAGEIE 167

  Fly   134  133
             Worm   168  167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UK114NP_001260465.1 YjgF_YER057c_UK114_family 6..127 CDD:299145 60/120 (50%)
C23G10.2NP_741177.2 TIGR00004 41..162 CDD:129116 60/121 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160060
Domainoid 1 1.000 106 1.000 Domainoid score I4118
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4261
Inparanoid 1 1.050 121 1.000 Inparanoid score I3330
Isobase 1 0.950 - 0 Normalized mean entropy S674
OMA 1 1.010 - - QHG60620
OrthoDB 1 1.010 - - D1435276at2759
OrthoFinder 1 1.000 - - FOG0001697
OrthoInspector 1 1.000 - - oto17588
orthoMCL 1 0.900 - - OOG6_100612
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R724
SonicParanoid 1 1.000 - - X1603
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.