DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UK114 and Rida

DIOPT Version :9

Sequence 1:NP_001260465.1 Gene:UK114 / 34897 FlyBaseID:FBgn0086691 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_032313.2 Gene:Rida / 15473 MGIID:1095401 Length:135 Species:Mus musculus


Alignment Length:130 Identity:69/130 - (53%)
Similarity:92/130 - (70%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTIVRKLISTANAAKPVAPYNQAVVADRTVYVSGCLGLDKDTMKLVPGGPTEQAQKALENLEAV 65
            ||:|:||:|||..|...:.||:|||..|||:|:||.:|||..:.:|||||..|:|::||:||..:
Mouse     1 MSSIIRKVISTTKAPAAIGPYSQAVQVDRTIYISGQVGLDPSSGQLVPGGVVEEAKQALKNLGEI 65

  Fly    66 LKAADSGVDKVIKNTVFLKDLNDFGAVNEVYKRVFNKDFPARSCFQVAKLPMDALVEIECIALTG 130
            ||||....:.|:|.||.|.|:||||.|||:||..|....|||:.:|||.||..:.||||.||:.|
Mouse    66 LKAAGCDFNNVVKTTVLLADMNDFGTVNEIYKTYFQGSLPARAAYQVAALPRGSRVEIEAIAVQG 130

  Fly   131  130
            Mouse   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UK114NP_001260465.1 YjgF_YER057c_UK114_family 6..127 CDD:299145 63/120 (53%)
RidaNP_032313.2 TIGR00004 6..129 CDD:129116 65/122 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838202
Domainoid 1 1.000 123 1.000 Domainoid score I5578
eggNOG 1 0.900 - - E1_COG0251
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4261
Inparanoid 1 1.050 141 1.000 Inparanoid score I4475
Isobase 1 0.950 - 0 Normalized mean entropy S674
OMA 1 1.010 - - QHG60620
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001697
OrthoInspector 1 1.000 - - oto92522
orthoMCL 1 0.900 - - OOG6_100612
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R724
SonicParanoid 1 1.000 - - X1603
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.640

Return to query results.
Submit another query.